Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 51098..51660 | Replicon | plasmid pVFBJ07-1 |
| Accession | NZ_CP128202 | ||
| Organism | Vibrio furnissii strain VFBJ07 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QSU96_RS23520 | Protein ID | WP_038152854.1 |
| Coordinates | 51358..51660 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | QSU96_RS23515 | Protein ID | WP_004729600.1 |
| Coordinates | 51098..51343 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSU96_RS23500 (QSU96_23500) | 48683..48910 | - | 228 | WP_038152853.1 | hypothetical protein | - |
| QSU96_RS23505 (QSU96_23505) | 49140..50060 | + | 921 | WP_286282545.1 | IS5 family transposase | - |
| QSU96_RS23510 (QSU96_23510) | 50361..50897 | - | 537 | Protein_44 | recombinase family protein | - |
| QSU96_RS23515 (QSU96_23515) | 51098..51343 | + | 246 | WP_004729600.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QSU96_RS23520 (QSU96_23520) | 51358..51660 | + | 303 | WP_038152854.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QSU96_RS23525 (QSU96_23525) | 51657..52259 | - | 603 | WP_004729602.1 | recombinase family protein | - |
| QSU96_RS23530 (QSU96_23530) | 52869..53945 | - | 1077 | WP_038152856.1 | replication initiation protein | - |
| QSU96_RS23535 (QSU96_23535) | 54889..55611 | + | 723 | WP_004729604.1 | hypothetical protein | - |
| QSU96_RS23540 (QSU96_23540) | 55601..56350 | + | 750 | WP_119299138.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..71247 | 71247 | |
| - | flank | IS/Tn | - | - | 49140..50060 | 920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11644.32 Da Isoelectric Point: 6.7572
>T284403 WP_038152854.1 NZ_CP128202:51358-51660 [Vibrio furnissii]
MSSYKLSPLAQSDLTDIRRYTIEHWGSTQWSVYFNELQESMSLLASNELIGIQIPEMGERYYRFPLKHHVIYYITQEDHI
VIVAVLGKHMSPAKHFASIS
MSSYKLSPLAQSDLTDIRRYTIEHWGSTQWSVYFNELQESMSLLASNELIGIQIPEMGERYYRFPLKHHVIYYITQEDHI
VIVAVLGKHMSPAKHFASIS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|