Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2214788..2215332 | Replicon | chromosome |
Accession | NZ_CP128200 | ||
Organism | Vibrio furnissii strain VFBJ07 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QSU96_RS10235 | Protein ID | WP_286279486.1 |
Coordinates | 2214788..2215087 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0Q2N1Z8 |
Locus tag | QSU96_RS10240 | Protein ID | WP_055466056.1 |
Coordinates | 2215075..2215332 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSU96_RS10205 (QSU96_10205) | 2210118..2210846 | + | 729 | WP_172561535.1 | FliA/WhiG family RNA polymerase sigma factor | - |
QSU96_RS10210 (QSU96_10210) | 2210856..2211713 | + | 858 | WP_004725096.1 | flagellar motor stator protein MotA | - |
QSU96_RS10215 (QSU96_10215) | 2211713..2212705 | + | 993 | WP_055466059.1 | flagellar motor protein MotB | - |
QSU96_RS10220 (QSU96_10220) | 2212780..2213067 | + | 288 | WP_014204723.1 | hypothetical protein | - |
QSU96_RS10225 (QSU96_10225) | 2213204..2213734 | + | 531 | WP_004725093.1 | copper resistance protein NlpE | - |
QSU96_RS10230 (QSU96_10230) | 2214078..2214353 | + | 276 | WP_004725092.1 | hypothetical protein | - |
QSU96_RS10235 (QSU96_10235) | 2214788..2215087 | - | 300 | WP_286279486.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QSU96_RS10240 (QSU96_10240) | 2215075..2215332 | - | 258 | WP_055466056.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QSU96_RS10245 (QSU96_10245) | 2215547..2215987 | - | 441 | WP_222731879.1 | hypothetical protein | - |
QSU96_RS10250 (QSU96_10250) | 2215984..2217090 | - | 1107 | WP_286279492.1 | hypothetical protein | - |
QSU96_RS10255 (QSU96_10255) | 2217566..2218330 | - | 765 | WP_286279493.1 | IclR family transcriptional regulator | - |
QSU96_RS10260 (QSU96_10260) | 2218445..2219752 | - | 1308 | WP_024373226.1 | TRAP transporter large permease | - |
QSU96_RS10265 (QSU96_10265) | 2219762..2220289 | - | 528 | WP_004725085.1 | TRAP transporter small permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11451.41 Da Isoelectric Point: 4.6561
>T284401 WP_286279486.1 NZ_CP128200:c2215087-2214788 [Vibrio furnissii]
MAEIIWTEPALSDLNDIAEYIALENVAAAKQLVQTIFAKVERLENFPESGRIPPELALLSYRELVVNPCRIFYKFDGDKV
FILFVMRSERDLRKFLLGM
MAEIIWTEPALSDLNDIAEYIALENVAAAKQLVQTIFAKVERLENFPESGRIPPELALLSYRELVVNPCRIFYKFDGDKV
FILFVMRSERDLRKFLLGM
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|