Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2370887..2371449 | Replicon | chromosome |
Accession | NZ_CP128197 | ||
Organism | Gordonia sp. Swx-4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PWF70_RS10735 | Protein ID | WP_286352949.1 |
Coordinates | 2371159..2371449 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A6G7W6R5 |
Locus tag | PWF70_RS10730 | Protein ID | WP_055477309.1 |
Coordinates | 2370887..2371162 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWF70_RS10705 (PWF70_10705) | 2366737..2367384 | + | 648 | WP_035752370.1 | hypothetical protein | - |
PWF70_RS10710 (PWF70_10710) | 2367418..2367807 | - | 390 | WP_035752373.1 | DUF1304 domain-containing protein | - |
PWF70_RS10715 (PWF70_10715) | 2368058..2368891 | + | 834 | WP_035752376.1 | DUF4436 family protein | - |
PWF70_RS10720 (PWF70_10720) | 2369219..2369596 | + | 378 | WP_035752553.1 | SRPBCC family protein | - |
PWF70_RS10725 (PWF70_10725) | 2369726..2370409 | - | 684 | WP_051405879.1 | hypothetical protein | - |
PWF70_RS10730 (PWF70_10730) | 2370887..2371162 | + | 276 | WP_055477309.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PWF70_RS10735 (PWF70_10735) | 2371159..2371449 | + | 291 | WP_286352949.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWF70_RS10740 (PWF70_10740) | 2371468..2371674 | - | 207 | WP_055477311.1 | hypothetical protein | - |
PWF70_RS10745 (PWF70_10745) | 2372342..2372575 | - | 234 | WP_055477307.1 | hypothetical protein | - |
PWF70_RS10750 (PWF70_10750) | 2372692..2373045 | + | 354 | WP_055477306.1 | hypothetical protein | - |
PWF70_RS10755 (PWF70_10755) | 2373164..2373403 | - | 240 | WP_055477305.1 | hypothetical protein | - |
PWF70_RS10760 (PWF70_10760) | 2373438..2375498 | - | 2061 | WP_068970440.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2370887..2411659 | 40772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10924.37 Da Isoelectric Point: 9.7360
>T284400 WP_286352949.1 NZ_CP128197:2371159-2371449 [Gordonia sp. Swx-4]
MSDAPTDSSAPYRVDVASPARRDLQRLPSRIVHAVIEFISGPLAENPHRLSKPLRDDLADLHSARRGDYRILLRIDDPNH
TIVIVRIDHRAHAYRT
MSDAPTDSSAPYRVDVASPARRDLQRLPSRIVHAVIEFISGPLAENPHRLSKPLRDDLADLHSARRGDYRILLRIDDPNH
TIVIVRIDHRAHAYRT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|