Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 313222..313858 | Replicon | chromosome |
Accession | NZ_CP128196 | ||
Organism | Neobacillus mesonae strain NS-6 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A3Q9QS43 |
Locus tag | P3L48_RS01625 | Protein ID | WP_041967053.1 |
Coordinates | 313508..313858 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | P3L48_RS01620 | Protein ID | WP_191276993.1 |
Coordinates | 313222..313503 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3L48_RS01600 | 309464..310045 | - | 582 | WP_286230441.1 | rhomboid family intramembrane serine protease | - |
P3L48_RS01605 | 310136..310486 | + | 351 | WP_286230442.1 | holo-ACP synthase | - |
P3L48_RS01610 | 310651..311658 | + | 1008 | WP_286230443.1 | DUF4367 domain-containing protein | - |
P3L48_RS01615 | 311780..312943 | + | 1164 | WP_286230444.1 | alanine racemase | - |
P3L48_RS01620 | 313222..313503 | + | 282 | WP_191276993.1 | YlcI/YnfO family protein | Antitoxin |
P3L48_RS01625 | 313508..313858 | + | 351 | WP_041967053.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P3L48_RS01630 | 314030..316201 | + | 2172 | WP_286230445.1 | Tex family protein | - |
P3L48_RS01635 | 316222..316335 | - | 114 | WP_127484595.1 | cortex morphogenetic protein CmpA | - |
P3L48_RS01640 | 316433..316912 | + | 480 | WP_127484597.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13020.06 Da Isoelectric Point: 4.8998
>T284398 WP_041967053.1 NZ_CP128196:313508-313858 [Neobacillus mesonae]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|