Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 167526..168196 Replicon plasmid pVir_KP0714
Accession NZ_CP128192
Organism Klebsiella pneumoniae strain KP0714

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QSG82_RS28235 Protein ID WP_004213072.1
Coordinates 167753..168196 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QSG82_RS28230 Protein ID WP_004213073.1
Coordinates 167526..167756 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSG82_RS28205 (QSG82_28205) 163749..164648 - 900 WP_004225022.1 nucleotide-binding protein -
QSG82_RS28210 (QSG82_28210) 164638..164928 - 291 WP_004213078.1 hypothetical protein -
QSG82_RS28215 (QSG82_28215) 165280..165486 + 207 WP_004213077.1 hypothetical protein -
QSG82_RS28220 (QSG82_28220) 165476..165769 - 294 WP_004213076.1 hypothetical protein -
QSG82_RS28225 (QSG82_28225) 165785..166918 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
QSG82_RS28230 (QSG82_28230) 167526..167756 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QSG82_RS28235 (QSG82_28235) 167753..168196 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QSG82_RS28240 (QSG82_28240) 168345..168596 + 252 WP_186987481.1 hypothetical protein -
QSG82_RS28245 (QSG82_28245) 168619..168923 - 305 Protein_193 transposase -
QSG82_RS28250 (QSG82_28250) 169340..169978 + 639 WP_032488580.1 mucoid phenotype regulator RmpA2 -
QSG82_RS28255 (QSG82_28255) 170047..171027 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
QSG82_RS28260 (QSG82_28260) 171696..172099 - 404 Protein_196 GAF domain-containing protein -
QSG82_RS28265 (QSG82_28265) 172190..173110 - 921 WP_004213934.1 DUF1471 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 rmpA / iutA / iucD / iucC / iucB / iucA 1..254123 254123
- flank IS/Tn - - 170047..171027 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T284392 WP_004213072.1 NZ_CP128192:167753-168196 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT284392 WP_004213073.1 NZ_CP128192:167526-167756 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References