Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 122928..123679 | Replicon | plasmid pVir_KP0714 |
Accession | NZ_CP128192 | ||
Organism | Klebsiella pneumoniae strain KP0714 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | QSG82_RS28005 | Protein ID | WP_014386536.1 |
Coordinates | 123197..123679 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | QSG82_RS28000 | Protein ID | WP_004902250.1 |
Coordinates | 122928..123206 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSG82_RS27965 (QSG82_27965) | 118571..118996 | - | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
QSG82_RS27970 (QSG82_27970) | 119024..119299 | - | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
QSG82_RS27975 (QSG82_27975) | 119315..119680 | - | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
QSG82_RS27980 (QSG82_27980) | 119752..120207 | + | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
QSG82_RS27985 (QSG82_27985) | 120860..121318 | + | 459 | WP_014386535.1 | hypothetical protein | - |
QSG82_RS27990 (QSG82_27990) | 122148..122489 | + | 342 | WP_004902257.1 | hypothetical protein | - |
QSG82_RS27995 (QSG82_27995) | 122597..122809 | + | 213 | WP_004902255.1 | hypothetical protein | - |
QSG82_RS28000 (QSG82_28000) | 122928..123206 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
QSG82_RS28005 (QSG82_28005) | 123197..123679 | + | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
QSG82_RS28010 (QSG82_28010) | 124714..125253 | + | 540 | WP_004902239.1 | hypothetical protein | - |
QSG82_RS28015 (QSG82_28015) | 125358..125750 | + | 393 | WP_032442757.1 | hypothetical protein | - |
QSG82_RS28020 (QSG82_28020) | 125851..126606 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
QSG82_RS28025 (QSG82_28025) | 126633..127280 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 | rmpA / iutA / iucD / iucC / iucB / iucA | 1..254123 | 254123 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T284391 WP_014386536.1 NZ_CP128192:123197-123679 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |