Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 74368..74890 Replicon plasmid pVir_KP0714
Accession NZ_CP128192
Organism Klebsiella pneumoniae strain KP0714

Toxin (Protein)


Gene name stbE Uniprot ID A0A2J4R0S6
Locus tag QSG82_RS27725 Protein ID WP_004181778.1
Coordinates 74368..74652 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID A0A2J4R0U8
Locus tag QSG82_RS27730 Protein ID WP_004181777.1
Coordinates 74642..74890 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSG82_RS27695 (QSG82_27695) 70122..70517 + 396 WP_016947072.1 hypothetical protein -
QSG82_RS27700 (QSG82_27700) 70681..71649 + 969 WP_013362812.1 IS5-like element IS903B family transposase -
QSG82_RS27705 (QSG82_27705) 71797..72501 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
QSG82_RS27710 (QSG82_27710) 72544..72717 + 174 Protein_86 zinc ribbon domain-containing protein -
QSG82_RS27715 (QSG82_27715) 72988..74214 - 1227 WP_040209639.1 RNA-guided endonuclease TnpB family protein -
QSG82_RS27720 (QSG82_27720) 74250..74351 + 102 Protein_88 IS200/IS605 family transposase -
QSG82_RS27725 (QSG82_27725) 74368..74652 - 285 WP_004181778.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QSG82_RS27730 (QSG82_27730) 74642..74890 - 249 WP_004181777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QSG82_RS27735 (QSG82_27735) 75181..76041 + 861 WP_286338809.1 UvrD-helicase domain-containing protein -
QSG82_RS27740 (QSG82_27740) 76080..77060 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
QSG82_RS27745 (QSG82_27745) 77086..78180 + 1095 WP_286338810.1 ATP-dependent helicase -
QSG82_RS27750 (QSG82_27750) 78514..79500 + 987 WP_025368599.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 rmpA / iutA / iucD / iucC / iucB / iucA 1..254123 254123
- inside IScluster/Tn - - 70681..77060 6379


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10970.69 Da        Isoelectric Point: 10.6516

>T284390 WP_004181778.1 NZ_CP128192:c74652-74368 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8925.17 Da        Isoelectric Point: 3.8209

>AT284390 WP_004181777.1 NZ_CP128192:c74890-74642 [Klebsiella pneumoniae]
MAFQVLTTTAASITELKRDPMGTFNAGEGAPVAILNRNEPAFYCVPPALYAQLMELLEDQELGRIADERIGEAVIEVSLD
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4R0S6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4R0U8

References