Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4165077..4165696 Replicon chromosome
Accession NZ_CP128191
Organism Klebsiella pneumoniae strain KP0714

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QSG82_RS21155 Protein ID WP_002892050.1
Coordinates 4165478..4165696 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QSG82_RS21150 Protein ID WP_002892066.1
Coordinates 4165077..4165451 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSG82_RS21140 (QSG82_21140) 4160229..4161422 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QSG82_RS21145 (QSG82_21145) 4161445..4164591 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QSG82_RS21150 (QSG82_21150) 4165077..4165451 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QSG82_RS21155 (QSG82_21155) 4165478..4165696 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QSG82_RS21160 (QSG82_21160) 4165855..4166421 + 567 WP_002892030.1 maltose O-acetyltransferase -
QSG82_RS21165 (QSG82_21165) 4166393..4166533 - 141 WP_004147370.1 hypothetical protein -
QSG82_RS21170 (QSG82_21170) 4166554..4167024 + 471 WP_002892026.1 YlaC family protein -
QSG82_RS21175 (QSG82_21175) 4166999..4168450 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QSG82_RS21180 (QSG82_21180) 4168551..4169249 + 699 WP_002892021.1 GNAT family protein -
QSG82_RS21185 (QSG82_21185) 4169246..4169386 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QSG82_RS21190 (QSG82_21190) 4169386..4169649 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T284384 WP_002892050.1 NZ_CP128191:4165478-4165696 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT284384 WP_002892066.1 NZ_CP128191:4165077-4165451 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References