Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4165077..4165696 | Replicon | chromosome |
Accession | NZ_CP128191 | ||
Organism | Klebsiella pneumoniae strain KP0714 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QSG82_RS21155 | Protein ID | WP_002892050.1 |
Coordinates | 4165478..4165696 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QSG82_RS21150 | Protein ID | WP_002892066.1 |
Coordinates | 4165077..4165451 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSG82_RS21140 (QSG82_21140) | 4160229..4161422 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QSG82_RS21145 (QSG82_21145) | 4161445..4164591 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QSG82_RS21150 (QSG82_21150) | 4165077..4165451 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QSG82_RS21155 (QSG82_21155) | 4165478..4165696 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QSG82_RS21160 (QSG82_21160) | 4165855..4166421 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QSG82_RS21165 (QSG82_21165) | 4166393..4166533 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QSG82_RS21170 (QSG82_21170) | 4166554..4167024 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QSG82_RS21175 (QSG82_21175) | 4166999..4168450 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
QSG82_RS21180 (QSG82_21180) | 4168551..4169249 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QSG82_RS21185 (QSG82_21185) | 4169246..4169386 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QSG82_RS21190 (QSG82_21190) | 4169386..4169649 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284384 WP_002892050.1 NZ_CP128191:4165478-4165696 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT284384 WP_002892066.1 NZ_CP128191:4165077-4165451 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |