Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 932908..933562 | Replicon | chromosome |
Accession | NZ_CP128191 | ||
Organism | Klebsiella pneumoniae strain KP0714 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R4YHX2 |
Locus tag | QSG82_RS04800 | Protein ID | WP_004144731.1 |
Coordinates | 933155..933562 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QSG82_RS04795 | Protein ID | WP_002916312.1 |
Coordinates | 932908..933174 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSG82_RS04770 (QSG82_04770) | 928064..929497 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
QSG82_RS04775 (QSG82_04775) | 929616..930344 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QSG82_RS04780 (QSG82_04780) | 930394..930705 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
QSG82_RS04785 (QSG82_04785) | 930869..931528 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
QSG82_RS04790 (QSG82_04790) | 931679..932662 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
QSG82_RS04795 (QSG82_04795) | 932908..933174 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QSG82_RS04800 (QSG82_04800) | 933155..933562 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
QSG82_RS04805 (QSG82_04805) | 933569..934090 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
QSG82_RS04810 (QSG82_04810) | 934191..935087 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QSG82_RS04815 (QSG82_04815) | 935110..935823 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QSG82_RS04820 (QSG82_04820) | 935829..937562 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T284378 WP_004144731.1 NZ_CP128191:933155-933562 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378E4P6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |