Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PrpT-parD/RHH(antitoxin) |
Location | 2881543..2882071 | Replicon | chromosome |
Accession | NZ_CP128185 | ||
Organism | Aliiglaciecola sp. LCG003 |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | - |
Locus tag | QR722_RS12440 | Protein ID | WP_286283179.1 |
Coordinates | 2881543..2881833 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QR722_RS12445 | Protein ID | WP_286283180.1 |
Coordinates | 2881826..2882071 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR722_RS12420 (QR722_12420) | 2877249..2877773 | - | 525 | WP_286283175.1 | ribosome maturation factor RimM | - |
QR722_RS12425 (QR722_12425) | 2877801..2878052 | - | 252 | WP_286283176.1 | 30S ribosomal protein S16 | - |
QR722_RS12430 (QR722_12430) | 2878563..2880647 | + | 2085 | WP_286283177.1 | M13 family metallopeptidase | - |
QR722_RS12435 (QR722_12435) | 2880766..2881521 | - | 756 | WP_286283178.1 | tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE | - |
QR722_RS12440 (QR722_12440) | 2881543..2881833 | - | 291 | WP_286283179.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QR722_RS12445 (QR722_12445) | 2881826..2882071 | - | 246 | WP_286283180.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QR722_RS12450 (QR722_12450) | 2882182..2882286 | - | 105 | Protein_2436 | tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE | - |
QR722_RS12455 (QR722_12455) | 2882740..2884143 | - | 1404 | WP_286283181.1 | methyl-accepting chemotaxis protein | - |
QR722_RS12460 (QR722_12460) | 2884878..2885318 | + | 441 | WP_286283182.1 | hypothetical protein | - |
QR722_RS12465 (QR722_12465) | 2885431..2885883 | - | 453 | WP_286283183.1 | hypothetical protein | - |
QR722_RS12470 (QR722_12470) | 2886070..2886747 | - | 678 | WP_286283185.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10965.55 Da Isoelectric Point: 4.7468
>T284372 WP_286283179.1 NZ_CP128185:c2881833-2881543 [Aliiglaciecola sp. LCG003]
MASYRLAPLAELDMEAIGEYSFEQWGINQANYYADELVLAFEGLAESPCLGVSCDNVRVGYKFYRQGKHLIYFKTTDYGV
AVIRILHERMSPSLFL
MASYRLAPLAELDMEAIGEYSFEQWGINQANYYADELVLAFEGLAESPCLGVSCDNVRVGYKFYRQGKHLIYFKTTDYGV
AVIRILHERMSPSLFL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|