Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2060781..2061418 | Replicon | chromosome |
Accession | NZ_CP128184 | ||
Organism | Bacillus velezensis strain YJ0-1 isolate soil |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QRA13_RS09875 | Protein ID | WP_003156187.1 |
Coordinates | 2060781..2061131 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QRA13_RS09880 | Protein ID | WP_003156188.1 |
Coordinates | 2061137..2061418 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA13_RS09835 (QRA13_09835) | 2055821..2056423 | - | 603 | WP_082999005.1 | PP2C family serine/threonine-protein phosphatase | - |
QRA13_RS09840 (QRA13_09840) | 2056423..2057211 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QRA13_RS09845 (QRA13_09845) | 2057177..2057659 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
QRA13_RS09850 (QRA13_09850) | 2057656..2057985 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QRA13_RS09855 (QRA13_09855) | 2058049..2059056 | - | 1008 | WP_044802655.1 | PP2C family protein-serine/threonine phosphatase | - |
QRA13_RS09860 (QRA13_09860) | 2059068..2059469 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QRA13_RS09865 (QRA13_09865) | 2059472..2059837 | - | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
QRA13_RS09870 (QRA13_09870) | 2059842..2060663 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
QRA13_RS09875 (QRA13_09875) | 2060781..2061131 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QRA13_RS09880 (QRA13_09880) | 2061137..2061418 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QRA13_RS09885 (QRA13_09885) | 2061538..2062707 | - | 1170 | WP_038457028.1 | alanine racemase | - |
QRA13_RS09890 (QRA13_09890) | 2062824..2063831 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QRA13_RS09895 (QRA13_09895) | 2063996..2064361 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
QRA13_RS09900 (QRA13_09900) | 2064454..2065053 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284371 WP_003156187.1 NZ_CP128184:c2061131-2060781 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|