Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1218747..1219664 | Replicon | chromosome |
| Accession | NZ_CP128184 | ||
| Organism | Bacillus velezensis strain YJ0-1 isolate soil | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | QRA13_RS05335 | Protein ID | WP_007407256.1 |
| Coordinates | 1218747..1219493 (+) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | QRA13_RS05340 | Protein ID | WP_003154807.1 |
| Coordinates | 1219494..1219664 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRA13_RS05315 (QRA13_05315) | 1214139..1215089 | - | 951 | WP_224224209.1 | ring-cleaving dioxygenase | - |
| QRA13_RS05320 (QRA13_05320) | 1215412..1216728 | + | 1317 | WP_224224208.1 | amino acid permease | - |
| QRA13_RS05325 (QRA13_05325) | 1217014..1217631 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
| QRA13_RS05330 (QRA13_05330) | 1217644..1218642 | + | 999 | WP_044802872.1 | inorganic phosphate transporter | - |
| QRA13_RS05335 (QRA13_05335) | 1218747..1219493 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QRA13_RS05340 (QRA13_05340) | 1219494..1219664 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| QRA13_RS05345 (QRA13_05345) | 1219761..1219886 | + | 126 | WP_003154809.1 | hypothetical protein | - |
| QRA13_RS05350 (QRA13_05350) | 1219921..1220799 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QRA13_RS05355 (QRA13_05355) | 1220813..1221076 | - | 264 | WP_003154813.1 | phage holin | - |
| QRA13_RS05360 (QRA13_05360) | 1221090..1221353 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| QRA13_RS05365 (QRA13_05365) | 1221406..1222167 | - | 762 | WP_045207175.1 | hypothetical protein | - |
| QRA13_RS05370 (QRA13_05370) | 1222224..1222421 | - | 198 | WP_007610833.1 | XkdX family protein | - |
| QRA13_RS05375 (QRA13_05375) | 1222426..1222797 | - | 372 | WP_032874603.1 | XkdW family protein | - |
| QRA13_RS05380 (QRA13_05380) | 1222810..1224432 | - | 1623 | WP_224224207.1 | pyocin knob domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T284370 WP_007407256.1 NZ_CP128184:1218747-1219493 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|