Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 266071..266719 | Replicon | chromosome |
Accession | NZ_CP128182 | ||
Organism | Stenotrophomonas maltophilia strain a7 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QP025_RS01215 | Protein ID | WP_005407702.1 |
Coordinates | 266071..266376 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | QP025_RS01220 | Protein ID | WP_005407703.1 |
Coordinates | 266417..266719 (+) | Length | 101 a.a. |
Genomic Context
Location: 263206..264171 (966 bp)
Type: Others
Protein ID: WP_043035430.1
Type: Others
Protein ID: WP_043035430.1
Location: 264168..264899 (732 bp)
Type: Others
Protein ID: WP_005407698.1
Type: Others
Protein ID: WP_005407698.1
Location: 264909..265763 (855 bp)
Type: Others
Protein ID: WP_005411958.1
Type: Others
Protein ID: WP_005411958.1
Location: 266071..266376 (306 bp)
Type: Toxin
Protein ID: WP_005407702.1
Type: Toxin
Protein ID: WP_005407702.1
Location: 266417..266719 (303 bp)
Type: Antitoxin
Protein ID: WP_005407703.1
Type: Antitoxin
Protein ID: WP_005407703.1
Location: 268359..269129 (771 bp)
Type: Others
Protein ID: WP_005411960.1
Type: Others
Protein ID: WP_005411960.1
Location: 269632..270552 (921 bp)
Type: Others
Protein ID: WP_201863758.1
Type: Others
Protein ID: WP_201863758.1
Location: 270713..270850 (138 bp)
Type: Others
Protein ID: WP_005407710.1
Type: Others
Protein ID: WP_005407710.1
Location: 271057..271278 (222 bp)
Type: Others
Protein ID: WP_004153772.1
Type: Others
Protein ID: WP_004153772.1
Location: 262025..262816 (792 bp)
Type: Others
Protein ID: WP_197569412.1
Type: Others
Protein ID: WP_197569412.1
Location: 262783..263061 (279 bp)
Type: Others
Protein ID: WP_005407696.1
Type: Others
Protein ID: WP_005407696.1
Location: 266977..267276 (300 bp)
Type: Others
Protein ID: WP_005407704.1
Type: Others
Protein ID: WP_005407704.1
Location: 267357..267764 (408 bp)
Type: Others
Protein ID: WP_005407705.1
Type: Others
Protein ID: WP_005407705.1
Location: 269154..269501 (348 bp)
Type: Others
Protein ID: WP_049454229.1
Type: Others
Protein ID: WP_049454229.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP025_RS01185 | 262025..262816 | - | 792 | WP_197569412.1 | zinc-dependent peptidase | - |
QP025_RS01190 | 262783..263061 | - | 279 | WP_005407696.1 | hypothetical protein | - |
QP025_RS01195 | 263206..264171 | + | 966 | WP_043035430.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
QP025_RS01200 | 264168..264899 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
QP025_RS01205 | 264909..265763 | + | 855 | WP_005411958.1 | SPOR domain-containing protein | - |
QP025_RS01215 | 266071..266376 | + | 306 | WP_005407702.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP025_RS01220 | 266417..266719 | + | 303 | WP_005407703.1 | putative addiction module antidote protein | Antitoxin |
QP025_RS01225 | 266977..267276 | - | 300 | WP_005407704.1 | hypothetical protein | - |
QP025_RS01230 | 267357..267764 | - | 408 | WP_005407705.1 | hypothetical protein | - |
QP025_RS01235 | 268359..269129 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
QP025_RS01240 | 269154..269501 | - | 348 | WP_049454229.1 | hypothetical protein | - |
QP025_RS01245 | 269632..270552 | + | 921 | WP_201863758.1 | arginase | - |
QP025_RS01250 | 270713..270850 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
QP025_RS01255 | 271057..271278 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11444.15 Da Isoelectric Point: 10.9897
>T284369 WP_005407702.1 NZ_CP128182:266071-266376 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp