Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 383400..384037 | Replicon | chromosome |
Accession | NZ_CP128168 | ||
Organism | Halobacillus sp. ACCC02827 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | L5NDX6 |
Locus tag | QRD89_RS02060 | Protein ID | WP_008632962.1 |
Coordinates | 383687..384037 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A7Z2SU23 |
Locus tag | QRD89_RS02055 | Protein ID | WP_026576976.1 |
Coordinates | 383400..383681 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD89_RS02035 (QRD89_02035) | 378967..379326 | + | 360 | WP_026576978.1 | holo-ACP synthase | - |
QRD89_RS02040 (QRD89_02040) | 379395..380888 | + | 1494 | WP_286096198.1 | NAD(P)H-hydrate dehydratase | - |
QRD89_RS02045 (QRD89_02045) | 380934..381956 | + | 1023 | WP_008632968.1 | outer membrane lipoprotein carrier protein LolA | - |
QRD89_RS02050 (QRD89_02050) | 382101..383249 | + | 1149 | WP_286096199.1 | alanine racemase | - |
QRD89_RS02055 (QRD89_02055) | 383400..383681 | + | 282 | WP_026576976.1 | hypothetical protein | Antitoxin |
QRD89_RS02060 (QRD89_02060) | 383687..384037 | + | 351 | WP_008632962.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QRD89_RS02065 (QRD89_02065) | 384253..385122 | + | 870 | WP_008632960.1 | RsbT co-antagonist protein RsbRA | - |
QRD89_RS02070 (QRD89_02070) | 385128..385484 | + | 357 | WP_008632953.1 | STAS domain-containing protein | - |
QRD89_RS02075 (QRD89_02075) | 385487..385888 | + | 402 | WP_008632951.1 | anti-sigma regulatory factor | - |
QRD89_RS02080 (QRD89_02080) | 385903..386913 | + | 1011 | WP_026576975.1 | PP2C family protein-serine/threonine phosphatase | - |
QRD89_RS02085 (QRD89_02085) | 386979..387308 | + | 330 | WP_008632949.1 | STAS domain-containing protein | - |
QRD89_RS02090 (QRD89_02090) | 387311..387787 | + | 477 | WP_008632948.1 | anti-sigma B factor RsbW | - |
QRD89_RS02095 (QRD89_02095) | 387759..388538 | + | 780 | WP_026576974.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12945.02 Da Isoelectric Point: 7.0122
>T284366 WP_008632962.1 NZ_CP128168:383687-384037 [Halobacillus sp. ACCC02827]
VIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAEKYGFERNSVILLEQI
RTIDKQRLTDKITQLDEPMMQQVNKSLQISLGLIDF
VIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAEKYGFERNSVILLEQI
RTIDKQRLTDKITQLDEPMMQQVNKSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z2SU39 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z2SU23 |