Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 256373..257015 | Replicon | chromosome |
| Accession | NZ_CP128153 | ||
| Organism | Bacillus sp. DX3.1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QRE67_RS01415 | Protein ID | WP_098338158.1 |
| Coordinates | 256665..257015 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | QRE67_RS01410 | Protein ID | WP_286123223.1 |
| Coordinates | 256373..256660 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRE67_RS01390 (QRE67_01390) | 252589..253137 | - | 549 | WP_286123220.1 | rhomboid family intramembrane serine protease | - |
| QRE67_RS01395 (QRE67_01395) | 253232..253591 | + | 360 | WP_286123221.1 | holo-ACP synthase | - |
| QRE67_RS01400 (QRE67_01400) | 253747..254694 | + | 948 | WP_286125167.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRE67_RS01405 (QRE67_01405) | 254818..255987 | + | 1170 | WP_286123222.1 | alanine racemase | - |
| QRE67_RS01410 (QRE67_01410) | 256373..256660 | + | 288 | WP_286123223.1 | antitoxin endoai | Antitoxin |
| QRE67_RS01415 (QRE67_01415) | 256665..257015 | + | 351 | WP_098338158.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRE67_RS01420 (QRE67_01420) | 257080..259248 | + | 2169 | WP_286123225.1 | Tex family protein | - |
| QRE67_RS01425 (QRE67_01425) | 259445..259561 | - | 117 | WP_286123227.1 | cortex morphogenetic protein CmpA | - |
| QRE67_RS01430 (QRE67_01430) | 259814..260272 | + | 459 | WP_286123229.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12962.06 Da Isoelectric Point: 5.7168
>T284364 WP_098338158.1 NZ_CP128153:256665-257015 [Bacillus sp. DX3.1]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDELMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDELMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|