Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2372597..2373572 | Replicon | chromosome |
Accession | NZ_CP128152 | ||
Organism | Bacillus albus strain SXL388 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A1J9UQ45 |
Locus tag | QRY64_RS14685 | Protein ID | WP_071756939.1 |
Coordinates | 2372597..2373334 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A1S9U9H9 |
Locus tag | QRY64_RS14690 | Protein ID | WP_048529988.1 |
Coordinates | 2373447..2373572 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRY64_RS14655 (QRY64_14645) | 2367804..2367887 | + | 84 | Protein_2341 | ABC transporter ATP-binding protein | - |
QRY64_RS14660 (QRY64_14650) | 2367946..2368656 | + | 711 | WP_128974812.1 | class I SAM-dependent methyltransferase | - |
QRY64_RS14665 (QRY64_14655) | 2368777..2369184 | + | 408 | WP_071756918.1 | VOC family protein | - |
QRY64_RS14670 (QRY64_14660) | 2369229..2370914 | - | 1686 | WP_270797182.1 | alpha-keto acid decarboxylase family protein | - |
QRY64_RS14675 (QRY64_14665) | 2371022..2371504 | + | 483 | WP_048529992.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QRY64_RS14680 (QRY64_14670) | 2371671..2372408 | + | 738 | WP_071756916.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
QRY64_RS14685 (QRY64_14675) | 2372597..2373334 | + | 738 | WP_071756939.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QRY64_RS14690 (QRY64_14680) | 2373447..2373572 | + | 126 | WP_048529988.1 | hypothetical protein | Antitoxin |
QRY64_RS14695 (QRY64_14685) | 2373648..2373824 | + | 177 | WP_000852620.1 | stage II sporulation protein SB | - |
QRY64_RS14700 (QRY64_14690) | 2373843..2374231 | - | 389 | Protein_2350 | YxeA family protein | - |
QRY64_RS14705 (QRY64_14695) | 2374448..2375917 | + | 1470 | WP_270797184.1 | beta-Ala-His dipeptidase | - |
QRY64_RS14710 (QRY64_14700) | 2376503..2376973 | - | 471 | WP_048529981.1 | DUF5065 family protein | - |
QRY64_RS14715 (QRY64_14705) | 2377427..2378086 | + | 660 | WP_270797185.1 | CatB-related O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28369.00 Da Isoelectric Point: 8.3034
>T284363 WP_071756939.1 NZ_CP128152:2372597-2373334 [Bacillus albus]
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEDYTKSLNAFLDSYGEKIGAKI
VVFESAKELNTNFRGIRSQFSTIVPFEHIEQLNEQKAVQVENVGIIPVKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEDYTKSLNAFLDSYGEKIGAKI
VVFESAKELNTNFRGIRSQFSTIVPFEHIEQLNEQKAVQVENVGIIPVKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J9UQ45 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S9U9H9 |