Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 239726..240368 | Replicon | chromosome |
| Accession | NZ_CP128152 | ||
| Organism | Bacillus albus strain SXL388 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | QRY64_RS03700 | Protein ID | WP_000635963.1 |
| Coordinates | 240018..240368 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | QRY64_RS03695 | Protein ID | WP_000004570.1 |
| Coordinates | 239726..240013 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRY64_RS03670 (QRY64_03660) | 234896..235858 | + | 963 | WP_048529174.1 | UV DNA damage repair endonuclease UvsE | - |
| QRY64_RS03675 (QRY64_03665) | 236020..236568 | - | 549 | WP_048529176.1 | rhomboid family intramembrane serine protease | - |
| QRY64_RS03680 (QRY64_03670) | 236661..237020 | + | 360 | WP_048529178.1 | holo-ACP synthase | - |
| QRY64_RS03685 (QRY64_03675) | 237177..238127 | + | 951 | WP_002096914.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRY64_RS03690 (QRY64_03680) | 238246..239415 | + | 1170 | WP_048529179.1 | alanine racemase | - |
| QRY64_RS03695 (QRY64_03685) | 239726..240013 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| QRY64_RS03700 (QRY64_03690) | 240018..240368 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRY64_RS03705 (QRY64_03695) | 240437..242605 | + | 2169 | WP_071757098.1 | Tex family protein | - |
| QRY64_RS03710 (QRY64_03700) | 242664..242780 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| QRY64_RS03715 (QRY64_03705) | 242976..243434 | + | 459 | WP_048529183.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T284362 WP_000635963.1 NZ_CP128152:240018-240368 [Bacillus albus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |