Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2442027..2443005 | Replicon | chromosome |
Accession | NZ_CP128149 | ||
Organism | Bacillus mycoides strain SIN3.2 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | J8I6P2 |
Locus tag | QRE62_RS16175 | Protein ID | WP_002017051.1 |
Coordinates | 2442027..2442767 (+) | Length | 247 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | QRE62_RS16180 | Protein ID | WP_000588712.1 |
Coordinates | 2442880..2443005 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRE62_RS16145 (QRE62_16135) | 2437129..2437890 | + | 762 | WP_286126733.1 | ABC transporter ATP-binding protein | - |
QRE62_RS16150 (QRE62_16140) | 2437996..2438706 | + | 711 | WP_002127421.1 | class I SAM-dependent methyltransferase | - |
QRE62_RS16155 (QRE62_16145) | 2438825..2439238 | + | 414 | WP_002012925.1 | VOC family protein | - |
QRE62_RS16160 (QRE62_16150) | 2439415..2440047 | - | 633 | WP_002017047.1 | type 1 glutamine amidotransferase family protein | - |
QRE62_RS16165 (QRE62_16155) | 2440321..2440797 | + | 477 | WP_113709452.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QRE62_RS16170 (QRE62_16160) | 2440951..2441688 | + | 738 | WP_286126734.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
QRE62_RS16175 (QRE62_16165) | 2442027..2442767 | + | 741 | WP_002017051.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QRE62_RS16180 (QRE62_16170) | 2442880..2443005 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
QRE62_RS16185 (QRE62_16175) | 2443081..2443257 | + | 177 | WP_002127426.1 | stage II sporulation protein SB | - |
QRE62_RS16190 (QRE62_16180) | 2443434..2444903 | + | 1470 | WP_002127427.1 | aminoacyl-histidine dipeptidase | - |
QRE62_RS16195 (QRE62_16185) | 2445263..2445412 | + | 150 | WP_002069316.1 | hypothetical protein | - |
QRE62_RS16200 (QRE62_16190) | 2446126..2446785 | + | 660 | WP_286126735.1 | CatB-related O-acetyltransferase | - |
QRE62_RS16205 (QRE62_16195) | 2447276..2447980 | + | 705 | WP_002085517.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28512.20 Da Isoelectric Point: 8.3034
>T284361 WP_002017051.1 NZ_CP128149:2442027-2442767 [Bacillus mycoides]
MTISNIRIGLFILAIVFIVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPTAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAVKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFIVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPTAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAVKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | J8I6P2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |