Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 239229..239871 | Replicon | chromosome |
| Accession | NZ_CP128149 | ||
| Organism | Bacillus mycoides strain SIN3.2 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | QRE62_RS05010 | Protein ID | WP_000635965.1 |
| Coordinates | 239521..239871 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | QRE62_RS05005 | Protein ID | WP_000004570.1 |
| Coordinates | 239229..239516 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRE62_RS04980 (QRE62_04970) | 234393..235355 | + | 963 | WP_002009966.1 | UV DNA damage repair endonuclease UvsE | - |
| QRE62_RS04985 (QRE62_04975) | 235524..236072 | - | 549 | WP_002139859.1 | rhomboid family intramembrane serine protease | - |
| QRE62_RS04990 (QRE62_04980) | 236164..236523 | + | 360 | WP_002009969.1 | holo-ACP synthase | - |
| QRE62_RS04995 (QRE62_04985) | 236680..237630 | + | 951 | WP_002124820.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRE62_RS05000 (QRE62_04990) | 237748..238917 | + | 1170 | WP_282915247.1 | alanine racemase | - |
| QRE62_RS05005 (QRE62_04995) | 239229..239516 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| QRE62_RS05010 (QRE62_05000) | 239521..239871 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRE62_RS05015 (QRE62_05005) | 239940..242108 | + | 2169 | WP_286126793.1 | Tex family protein | - |
| QRE62_RS05020 (QRE62_05010) | 242166..242282 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| QRE62_RS05025 (QRE62_05015) | 242493..242948 | + | 456 | WP_016095131.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T284360 WP_000635965.1 NZ_CP128149:239521-239871 [Bacillus mycoides]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |