Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2421807..2422785 | Replicon | chromosome |
Accession | NZ_CP128137 | ||
Organism | Bacillus mycoides strain SIN3.1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | R8N1U0 |
Locus tag | QRE64_RS12435 | Protein ID | WP_002032139.1 |
Coordinates | 2421807..2422547 (+) | Length | 247 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | QRE64_RS12440 | Protein ID | WP_000588712.1 |
Coordinates | 2422660..2422785 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRE64_RS12405 (QRE64_12395) | 2416860..2418212 | + | 1353 | WP_113709454.1 | DEAD/DEAH box helicase | - |
QRE64_RS12410 (QRE64_12400) | 2418401..2418484 | + | 84 | Protein_2361 | SAM-dependent methyltransferase | - |
QRE64_RS12415 (QRE64_12405) | 2418603..2419016 | + | 414 | WP_002012925.1 | VOC family protein | - |
QRE64_RS12420 (QRE64_12410) | 2419194..2419826 | - | 633 | WP_113709453.1 | type 1 glutamine amidotransferase family protein | - |
QRE64_RS12425 (QRE64_12415) | 2420101..2420577 | + | 477 | WP_113709452.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QRE64_RS12430 (QRE64_12420) | 2420731..2421468 | + | 738 | WP_002032137.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
QRE64_RS12435 (QRE64_12425) | 2421807..2422547 | + | 741 | WP_002032139.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QRE64_RS12440 (QRE64_12430) | 2422660..2422785 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
QRE64_RS12445 (QRE64_12435) | 2422861..2423037 | + | 177 | WP_002017052.1 | stage II sporulation protein SB | - |
QRE64_RS12450 (QRE64_12440) | 2423057..2423446 | - | 390 | WP_002085522.1 | YxeA family protein | - |
QRE64_RS12455 (QRE64_12445) | 2423698..2425167 | + | 1470 | WP_002127427.1 | aminoacyl-histidine dipeptidase | - |
QRE64_RS12460 (QRE64_12450) | 2425527..2425676 | + | 150 | WP_002127428.1 | hypothetical protein | - |
QRE64_RS12465 (QRE64_12455) | 2426436..2427095 | + | 660 | WP_002185858.1 | CatB-related O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28482.11 Da Isoelectric Point: 8.3034
>T284359 WP_002032139.1 NZ_CP128137:2421807-2422547 [Bacillus mycoides]
MTISNIRIGLFILAIVFIVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFTIKGIDLTLWKNLLMFTAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPTAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAVKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFIVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFTIKGIDLTLWKNLLMFTAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPTAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAVKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8N1U0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |