Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 240786..241428 | Replicon | chromosome |
| Accession | NZ_CP128137 | ||
| Organism | Bacillus mycoides strain SIN3.1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | QRE64_RS01350 | Protein ID | WP_000635965.1 |
| Coordinates | 241078..241428 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | QRE64_RS01345 | Protein ID | WP_000004570.1 |
| Coordinates | 240786..241073 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRE64_RS01320 (QRE64_01320) | 235949..236911 | + | 963 | WP_002009966.1 | UV DNA damage repair endonuclease UvsE | - |
| QRE64_RS01325 (QRE64_01325) | 237081..237629 | - | 549 | WP_002139859.1 | rhomboid family intramembrane serine protease | - |
| QRE64_RS01330 (QRE64_01330) | 237721..238080 | + | 360 | WP_002009969.1 | holo-ACP synthase | - |
| QRE64_RS01335 (QRE64_01335) | 238237..239187 | + | 951 | WP_002124820.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRE64_RS01340 (QRE64_01340) | 239305..240474 | + | 1170 | WP_282915247.1 | alanine racemase | - |
| QRE64_RS01345 (QRE64_01345) | 240786..241073 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| QRE64_RS01350 (QRE64_01350) | 241078..241428 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRE64_RS01355 (QRE64_01355) | 241497..243665 | + | 2169 | WP_113710264.1 | Tex family protein | - |
| QRE64_RS01360 (QRE64_01360) | 243723..243839 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| QRE64_RS01365 (QRE64_01365) | 244050..244505 | + | 456 | WP_016095131.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T284358 WP_000635965.1 NZ_CP128137:241078-241428 [Bacillus mycoides]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |