Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 271946..272585 | Replicon | chromosome |
| Accession | NZ_CP128118 | ||
| Organism | Peribacillus frigoritolerans strain LN4 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QRD90_RS01450 | Protein ID | WP_034306610.1 |
| Coordinates | 272235..272585 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | QRD90_RS01445 | Protein ID | WP_034306380.1 |
| Coordinates | 271946..272227 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD90_RS01425 (QRD90_01425) | 268083..268673 | - | 591 | WP_053537118.1 | rhomboid family intramembrane serine protease | - |
| QRD90_RS01430 (QRD90_01430) | 268781..269131 | + | 351 | WP_053537119.1 | holo-ACP synthase | - |
| QRD90_RS01435 (QRD90_01435) | 269375..270379 | + | 1005 | WP_053537120.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRD90_RS01440 (QRD90_01440) | 270598..271785 | + | 1188 | WP_252297071.1 | alanine racemase | - |
| QRD90_RS01445 (QRD90_01445) | 271946..272227 | + | 282 | WP_034306380.1 | antitoxin EndoAI | Antitoxin |
| QRD90_RS01450 (QRD90_01450) | 272235..272585 | + | 351 | WP_034306610.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QRD90_RS01455 (QRD90_01455) | 272997..273824 | + | 828 | WP_054398282.1 | RsbT co-antagonist protein RsbRA | - |
| QRD90_RS01460 (QRD90_01460) | 273827..274183 | + | 357 | WP_048682053.1 | STAS domain-containing protein | - |
| QRD90_RS01465 (QRD90_01465) | 274187..274588 | + | 402 | WP_053537122.1 | anti-sigma regulatory factor | - |
| QRD90_RS01470 (QRD90_01470) | 274598..275608 | + | 1011 | WP_252297072.1 | PP2C family protein-serine/threonine phosphatase | - |
| QRD90_RS01475 (QRD90_01475) | 275668..276000 | + | 333 | WP_034306369.1 | anti-sigma factor antagonist | - |
| QRD90_RS01480 (QRD90_01480) | 275997..276470 | + | 474 | WP_053537124.1 | anti-sigma B factor RsbW | - |
| QRD90_RS01485 (QRD90_01485) | 276448..277236 | + | 789 | WP_034306363.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12955.06 Da Isoelectric Point: 7.2029
>T284355 WP_034306610.1 NZ_CP128118:272235-272585 [Peribacillus frigoritolerans]
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|