Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 519039..519675 | Replicon | chromosome |
Accession | NZ_CP128116 | ||
Organism | Bacillus halotolerans strain KF17 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QRD86_RS03160 | Protein ID | WP_003156187.1 |
Coordinates | 519325..519675 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QRD86_RS03155 | Protein ID | WP_003225183.1 |
Coordinates | 519039..519320 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD86_RS03135 (515394) | 515394..515993 | - | 600 | WP_024120294.1 | rhomboid family intramembrane serine protease | - |
QRD86_RS03140 (516088) | 516088..516453 | + | 366 | WP_106020948.1 | holo-ACP synthase | - |
QRD86_RS03145 (516619) | 516619..517635 | + | 1017 | WP_106021112.1 | outer membrane lipoprotein carrier protein LolA | - |
QRD86_RS03150 (517752) | 517752..518921 | + | 1170 | WP_024120297.1 | alanine racemase | - |
QRD86_RS03155 (519039) | 519039..519320 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QRD86_RS03160 (519325) | 519325..519675 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QRD86_RS03165 (519791) | 519791..520615 | + | 825 | WP_081638235.1 | RsbT co-antagonist protein RsbRA | - |
QRD86_RS03170 (520620) | 520620..520985 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QRD86_RS03175 (520988) | 520988..521389 | + | 402 | WP_106020946.1 | serine/threonine-protein kinase RsbT | - |
QRD86_RS03180 (521401) | 521401..522408 | + | 1008 | WP_024120300.1 | phosphoserine phosphatase RsbU | - |
QRD86_RS03185 (522469) | 522469..522798 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
QRD86_RS03190 (522795) | 522795..523277 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
QRD86_RS03195 (523243) | 523243..524031 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
QRD86_RS03200 (524031) | 524031..524630 | + | 600 | WP_024120304.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284353 WP_003156187.1 NZ_CP128116:519325-519675 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|