Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 537395..538031 | Replicon | chromosome |
Accession | NZ_CP128114 | ||
Organism | Bacillus safensis strain G6S3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0P7G713 |
Locus tag | QRD88_RS02620 | Protein ID | WP_024425388.1 |
Coordinates | 537681..538031 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | QRD88_RS02615 | Protein ID | WP_003214273.1 |
Coordinates | 537395..537676 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD88_RS02595 (QRD88_02595) | 533541..534146 | - | 606 | WP_024425384.1 | rhomboid family intramembrane serine protease | - |
QRD88_RS02600 (QRD88_02600) | 534241..534606 | + | 366 | WP_047202005.1 | holo-ACP synthase | - |
QRD88_RS02605 (QRD88_02605) | 534767..535783 | + | 1017 | WP_087975235.1 | outer membrane lipoprotein-sorting protein | - |
QRD88_RS02610 (QRD88_02610) | 535925..537100 | + | 1176 | WP_212053075.1 | alanine racemase | - |
QRD88_RS02615 (QRD88_02615) | 537395..537676 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
QRD88_RS02620 (QRD88_02620) | 537681..538031 | + | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QRD88_RS02625 (QRD88_02625) | 538148..538978 | + | 831 | WP_044334717.1 | RsbT co-antagonist protein RsbRA | - |
QRD88_RS02630 (QRD88_02630) | 538983..539351 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
QRD88_RS02635 (QRD88_02635) | 539354..539755 | + | 402 | WP_024425390.1 | anti-sigma regulatory factor | - |
QRD88_RS02640 (QRD88_02640) | 539766..540773 | + | 1008 | WP_024425391.1 | PP2C family protein-serine/threonine phosphatase | - |
QRD88_RS02645 (QRD88_02645) | 540833..541162 | + | 330 | WP_024425392.1 | anti-sigma factor antagonist | - |
QRD88_RS02650 (QRD88_02650) | 541159..541647 | + | 489 | WP_024425393.1 | anti-sigma B factor RsbW | - |
QRD88_RS02655 (QRD88_02655) | 541613..542401 | + | 789 | WP_024425394.1 | RNA polymerase sigma factor SigB | - |
QRD88_RS02660 (QRD88_02660) | 542401..543000 | + | 600 | WP_024425395.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T284351 WP_024425388.1 NZ_CP128114:537681-538031 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P7G713 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |