Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 245596..246238 | Replicon | chromosome |
Accession | NZ_CP128112 | ||
Organism | Bacillus mycoides strain G5S2 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | QRX95_RS01495 | Protein ID | WP_000635965.1 |
Coordinates | 245888..246238 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QRX95_RS01490 | Protein ID | WP_000004570.1 |
Coordinates | 245596..245883 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRX95_RS01465 (QRX95_01465) | 240911..241873 | + | 963 | WP_002009966.1 | UV DNA damage repair endonuclease UvsE | - |
QRX95_RS01470 (QRX95_01470) | 241866..242438 | - | 573 | WP_002167128.1 | rhomboid family intramembrane serine protease | - |
QRX95_RS01475 (QRX95_01475) | 242531..242890 | + | 360 | WP_002009969.1 | holo-ACP synthase | - |
QRX95_RS01480 (QRX95_01480) | 243047..243997 | + | 951 | WP_002091373.1 | outer membrane lipoprotein carrier protein LolA | - |
QRX95_RS01485 (QRX95_01485) | 244115..245284 | + | 1170 | WP_002009971.1 | alanine racemase | - |
QRX95_RS01490 (QRX95_01490) | 245596..245883 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QRX95_RS01495 (QRX95_01495) | 245888..246238 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QRX95_RS01500 (QRX95_01500) | 246307..248475 | + | 2169 | WP_002029442.1 | Tex family protein | - |
QRX95_RS01505 (QRX95_01505) | 248534..248650 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QRX95_RS01510 (QRX95_01510) | 248861..249316 | + | 456 | WP_016095131.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T284349 WP_000635965.1 NZ_CP128112:245888-246238 [Bacillus mycoides]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |