Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 618289..618925 | Replicon | chromosome |
| Accession | NZ_CP128109 | ||
| Organism | Bacillus altitudinis strain D9_B_49 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K2MHT4 |
| Locus tag | QRD87_RS03160 | Protein ID | WP_003214169.1 |
| Coordinates | 618575..618925 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | QRD87_RS03155 | Protein ID | WP_003214273.1 |
| Coordinates | 618289..618570 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD87_RS03135 (QRD87_03135) | 614443..615048 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
| QRD87_RS03140 (QRD87_03140) | 615143..615508 | + | 366 | WP_017358398.1 | holo-ACP synthase | - |
| QRD87_RS03145 (QRD87_03145) | 615669..616685 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
| QRD87_RS03150 (QRD87_03150) | 616814..617995 | + | 1182 | WP_035704220.1 | alanine racemase | - |
| QRD87_RS03155 (QRD87_03155) | 618289..618570 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| QRD87_RS03160 (QRD87_03160) | 618575..618925 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRD87_RS03165 (QRD87_03165) | 619040..619870 | + | 831 | WP_058336383.1 | RsbT co-antagonist protein RsbRA | - |
| QRD87_RS03170 (QRD87_03170) | 619875..620243 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| QRD87_RS03175 (QRD87_03175) | 620246..620647 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
| QRD87_RS03180 (QRD87_03180) | 620658..621665 | + | 1008 | WP_008346904.1 | PP2C family protein-serine/threonine phosphatase | - |
| QRD87_RS03185 (QRD87_03185) | 621725..622054 | + | 330 | WP_008346902.1 | anti-sigma factor antagonist | - |
| QRD87_RS03190 (QRD87_03190) | 622051..622539 | + | 489 | WP_007496471.1 | anti-sigma B factor RsbW | - |
| QRD87_RS03195 (QRD87_03195) | 622505..623293 | + | 789 | WP_025206796.1 | RNA polymerase sigma factor SigB | - |
| QRD87_RS03200 (QRD87_03200) | 623293..623892 | + | 600 | WP_008346897.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T284348 WP_003214169.1 NZ_CP128109:618575-618925 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K2MHT4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |