Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 247748..248390 | Replicon | chromosome |
Accession | NZ_CP128107 | ||
Organism | Bacillus cereus strain D5_B_69 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | QRY07_RS02070 | Protein ID | WP_000635965.1 |
Coordinates | 248040..248390 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QRY07_RS02065 | Protein ID | WP_000004570.1 |
Coordinates | 247748..248035 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRY07_RS02040 (QRY07_02040) | 242908..243870 | + | 963 | WP_286119119.1 | UV DNA damage repair endonuclease UvsE | - |
QRY07_RS02045 (QRY07_02045) | 244041..244589 | - | 549 | WP_002113424.1 | rhomboid family intramembrane serine protease | - |
QRY07_RS02050 (QRY07_02050) | 244682..245041 | + | 360 | WP_002201995.1 | holo-ACP synthase | - |
QRY07_RS02055 (QRY07_02055) | 245198..246148 | + | 951 | WP_002201994.1 | outer membrane lipoprotein carrier protein LolA | - |
QRY07_RS02060 (QRY07_02060) | 246266..247435 | + | 1170 | WP_002201993.1 | alanine racemase | - |
QRY07_RS02065 (QRY07_02065) | 247748..248035 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QRY07_RS02070 (QRY07_02070) | 248040..248390 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QRY07_RS02075 (QRY07_02075) | 248459..250627 | + | 2169 | WP_002201992.1 | Tex family protein | - |
QRY07_RS02080 (QRY07_02080) | 250685..250801 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QRY07_RS02085 (QRY07_02085) | 251009..251464 | + | 456 | WP_002201991.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T284346 WP_000635965.1 NZ_CP128107:248040-248390 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |