Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 71897..72522 | Replicon | plasmid pELP1.10 |
Accession | NZ_CP127882 | ||
Organism | Serratia marcescens strain ELP1.10 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QRD25_RS24180 | Protein ID | WP_286094224.1 |
Coordinates | 72124..72522 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QRD25_RS24175 | Protein ID | WP_286094223.1 |
Coordinates | 71897..72124 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD25_RS24175 (QRD25_24185) | 71897..72124 | + | 228 | WP_286094223.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QRD25_RS24180 (QRD25_24190) | 72124..72522 | + | 399 | WP_286094224.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QRD25_RS24185 (QRD25_24195) | 72558..74753 | - | 2196 | WP_286094225.1 | type IV conjugative transfer system coupling protein TraD | - |
QRD25_RS24190 (QRD25_24200) | 74743..74952 | - | 210 | WP_033641525.1 | hypothetical protein | - |
QRD25_RS24195 (QRD25_24205) | 74955..75488 | - | 534 | WP_286094226.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..129237 | 129237 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14712.98 Da Isoelectric Point: 7.8046
>T284344 WP_286094224.1 NZ_CP127882:72124-72522 [Serratia marcescens]
MLKYLLDTNTCIFTIKNKPAHVRERFSLNTSRLCISSVTLMELIYGAEKSQAPERNLAVLEGFIARLDVLNYDAAAAAHS
GQIRAELSRQGLPIGPFDLMIAGHARSQGLIVVTNHTREFARVDGLRIEDWC
MLKYLLDTNTCIFTIKNKPAHVRERFSLNTSRLCISSVTLMELIYGAEKSQAPERNLAVLEGFIARLDVLNYDAAAAAHS
GQIRAELSRQGLPIGPFDLMIAGHARSQGLIVVTNHTREFARVDGLRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|