Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4123876..4124545 | Replicon | chromosome |
Accession | NZ_CP127881 | ||
Organism | Serratia marcescens strain ELP1.10 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QRD25_RS19660 | Protein ID | WP_286093572.1 |
Coordinates | 4123876..4124298 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
Locus tag | QRD25_RS19665 | Protein ID | WP_004931679.1 |
Coordinates | 4124279..4124545 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD25_RS19640 (QRD25_19645) | 4119767..4121500 | - | 1734 | WP_015378966.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QRD25_RS19645 (QRD25_19650) | 4121507..4122223 | - | 717 | WP_004931688.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRD25_RS19650 (QRD25_19655) | 4122250..4123149 | - | 900 | WP_004931685.1 | site-specific tyrosine recombinase XerD | - |
QRD25_RS19655 (QRD25_19660) | 4123256..4123774 | + | 519 | WP_004931683.1 | flavodoxin FldB | - |
QRD25_RS19660 (QRD25_19665) | 4123876..4124298 | - | 423 | WP_286093572.1 | protein YgfX | Toxin |
QRD25_RS19665 (QRD25_19670) | 4124279..4124545 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
QRD25_RS19670 (QRD25_19675) | 4124866..4125858 | + | 993 | WP_286093573.1 | tRNA-modifying protein YgfZ | - |
QRD25_RS19675 (QRD25_19680) | 4125897..4126394 | - | 498 | WP_044030541.1 | DUF2165 domain-containing protein | - |
QRD25_RS19680 (QRD25_19685) | 4126545..4127219 | - | 675 | WP_021505704.1 | hemolysin III family protein | - |
QRD25_RS19685 (QRD25_19690) | 4127403..4128011 | + | 609 | WP_004931670.1 | HD domain-containing protein | - |
QRD25_RS19690 (QRD25_19695) | 4128049..4128975 | - | 927 | WP_286093574.1 | ribokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4120538..4192799 | 72261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16573.68 Da Isoelectric Point: 10.8114
>T284343 WP_286093572.1 NZ_CP127881:c4124298-4123876 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLVSDCMSKEEWRHLRQLLLYPPAGDGEQD
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLVSDCMSKEEWRHLRQLLLYPPAGDGEQD
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|