Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3764065..3764721 | Replicon | chromosome |
Accession | NZ_CP127881 | ||
Organism | Serratia marcescens strain ELP1.10 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QRD25_RS17975 | Protein ID | WP_004941566.1 |
Coordinates | 3764065..3764454 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
Locus tag | QRD25_RS17980 | Protein ID | WP_004941563.1 |
Coordinates | 3764458..3764721 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD25_RS17960 (QRD25_17965) | 3760532..3761962 | + | 1431 | WP_286093508.1 | multidrug transporter subunit MdtD | - |
QRD25_RS17965 (QRD25_17970) | 3761959..3763341 | + | 1383 | WP_004941570.1 | two-component system sensor histidine kinase BaeS | - |
QRD25_RS17970 (QRD25_17975) | 3763341..3764057 | + | 717 | WP_004941568.1 | two-component system response regulator BaeR | - |
QRD25_RS17975 (QRD25_17980) | 3764065..3764454 | - | 390 | WP_004941566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRD25_RS17980 (QRD25_17985) | 3764458..3764721 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QRD25_RS17985 (QRD25_17990) | 3765059..3765397 | + | 339 | WP_004941561.1 | YegP family protein | - |
QRD25_RS17990 (QRD25_17995) | 3765576..3766928 | + | 1353 | WP_004941558.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
QRD25_RS17995 (QRD25_18000) | 3767396..3768301 | + | 906 | WP_015378742.1 | lipid kinase YegS | - |
QRD25_RS18000 (QRD25_18005) | 3768470..3769684 | + | 1215 | WP_015378743.1 | D-galactonate dehydratase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14384.61 Da Isoelectric Point: 8.4983
>T284341 WP_004941566.1 NZ_CP127881:c3764454-3764065 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKVMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKVMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|