Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3025825..3026456 | Replicon | chromosome |
| Accession | NZ_CP127881 | ||
| Organism | Serratia marcescens strain ELP1.10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QRD25_RS14500 | Protein ID | WP_286093392.1 |
| Coordinates | 3025825..3026223 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A086GDB9 |
| Locus tag | QRD25_RS14505 | Protein ID | WP_004934853.1 |
| Coordinates | 3026223..3026456 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD25_RS14475 (QRD25_14480) | 3021398..3021772 | + | 375 | WP_004934837.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRD25_RS14480 (QRD25_14485) | 3021765..3022067 | + | 303 | WP_015378258.1 | DNA-binding transcriptional regulator | - |
| QRD25_RS14485 (QRD25_14490) | 3022070..3022474 | - | 405 | WP_044031010.1 | flagellar protein FlhE | - |
| QRD25_RS14490 (QRD25_14495) | 3022474..3024552 | - | 2079 | WP_286093391.1 | flagellar biosynthesis protein FlhA | - |
| QRD25_RS14495 (QRD25_14500) | 3024545..3025696 | - | 1152 | WP_004934847.1 | flagellar biosynthesis protein FlhB | - |
| QRD25_RS14500 (QRD25_14505) | 3025825..3026223 | - | 399 | WP_286093392.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRD25_RS14505 (QRD25_14510) | 3026223..3026456 | - | 234 | WP_004934853.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QRD25_RS14510 (QRD25_14515) | 3026582..3027226 | - | 645 | WP_004934858.1 | protein phosphatase CheZ | - |
| QRD25_RS14515 (QRD25_14520) | 3027237..3027626 | - | 390 | WP_004934862.1 | chemotaxis response regulator CheY | - |
| QRD25_RS14520 (QRD25_14525) | 3027729..3028778 | - | 1050 | WP_004934865.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| QRD25_RS14525 (QRD25_14530) | 3028778..3029650 | - | 873 | WP_025159837.1 | protein-glutamate O-methyltransferase CheR | - |
| QRD25_RS14530 (QRD25_14535) | 3029679..3031304 | - | 1626 | WP_280631488.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14893.02 Da Isoelectric Point: 9.4112
>T284338 WP_286093392.1 NZ_CP127881:c3026223-3025825 [Serratia marcescens]
MFSHMLDTNIVIYVIKRRPREVLEAFNRYAGKMVISSVTYGELVHGVEKSARPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTSIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL
MFSHMLDTNIVIYVIKRRPREVLEAFNRYAGKMVISSVTYGELVHGVEKSARPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTSIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|