Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3025825..3026456 Replicon chromosome
Accession NZ_CP127881
Organism Serratia marcescens strain ELP1.10

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QRD25_RS14500 Protein ID WP_286093392.1
Coordinates 3025825..3026223 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A086GDB9
Locus tag QRD25_RS14505 Protein ID WP_004934853.1
Coordinates 3026223..3026456 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRD25_RS14475 (QRD25_14480) 3021398..3021772 + 375 WP_004934837.1 type II toxin-antitoxin system RelE/ParE family toxin -
QRD25_RS14480 (QRD25_14485) 3021765..3022067 + 303 WP_015378258.1 DNA-binding transcriptional regulator -
QRD25_RS14485 (QRD25_14490) 3022070..3022474 - 405 WP_044031010.1 flagellar protein FlhE -
QRD25_RS14490 (QRD25_14495) 3022474..3024552 - 2079 WP_286093391.1 flagellar biosynthesis protein FlhA -
QRD25_RS14495 (QRD25_14500) 3024545..3025696 - 1152 WP_004934847.1 flagellar biosynthesis protein FlhB -
QRD25_RS14500 (QRD25_14505) 3025825..3026223 - 399 WP_286093392.1 type II toxin-antitoxin system VapC family toxin Toxin
QRD25_RS14505 (QRD25_14510) 3026223..3026456 - 234 WP_004934853.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRD25_RS14510 (QRD25_14515) 3026582..3027226 - 645 WP_004934858.1 protein phosphatase CheZ -
QRD25_RS14515 (QRD25_14520) 3027237..3027626 - 390 WP_004934862.1 chemotaxis response regulator CheY -
QRD25_RS14520 (QRD25_14525) 3027729..3028778 - 1050 WP_004934865.1 chemotaxis response regulator protein-glutamate methylesterase -
QRD25_RS14525 (QRD25_14530) 3028778..3029650 - 873 WP_025159837.1 protein-glutamate O-methyltransferase CheR -
QRD25_RS14530 (QRD25_14535) 3029679..3031304 - 1626 WP_280631488.1 methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-45)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14893.02 Da        Isoelectric Point: 9.4112

>T284338 WP_286093392.1 NZ_CP127881:c3026223-3025825 [Serratia marcescens]
MFSHMLDTNIVIYVIKRRPREVLEAFNRYAGKMVISSVTYGELVHGVEKSARPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTSIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL

Download         Length: 399 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8837.86 Da        Isoelectric Point: 4.7954

>AT284338 WP_004934853.1 NZ_CP127881:c3026456-3026223 [Serratia marcescens]
MTLGSVFTNNRTQAVRLPAEVRFPDTVSKVTVRVVGKERILAPVENTWDSFFCAENEVSDDFLNERAGQHQREREEL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDB9

References