Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1681543..1682068 Replicon chromosome
Accession NZ_CP127881
Organism Serratia marcescens strain ELP1.10

Toxin (Protein)


Gene name relE Uniprot ID A0A8B4GJ35
Locus tag QRD25_RS08030 Protein ID WP_033633469.1
Coordinates 1681543..1681827 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A8B4GIN1
Locus tag QRD25_RS08035 Protein ID WP_004928423.1
Coordinates 1681817..1682068 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRD25_RS08005 (QRD25_08005) 1676803..1677936 + 1134 WP_004938650.1 putrescine ABC transporter ATP-binding subunit PotG -
QRD25_RS08010 (QRD25_08010) 1677961..1678923 + 963 WP_021504359.1 putrescine ABC transporter permease PotH -
QRD25_RS08015 (QRD25_08015) 1678920..1679765 + 846 WP_004938644.1 putrescine ABC transporter permease PotI -
QRD25_RS08020 (QRD25_08020) 1679870..1680349 + 480 WP_015377294.1 YbjO family protein -
QRD25_RS08025 (QRD25_08025) 1680419..1681546 + 1128 WP_015377295.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
QRD25_RS08030 (QRD25_08030) 1681543..1681827 - 285 WP_033633469.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRD25_RS08035 (QRD25_08035) 1681817..1682068 - 252 WP_004928423.1 prevent-host-death protein Antitoxin
QRD25_RS08040 (QRD25_08040) 1682170..1682904 - 735 WP_015377297.1 arginine ABC transporter substrate-binding protein -
QRD25_RS08045 (QRD25_08045) 1683104..1683772 - 669 WP_004928418.1 arginine ABC transporter permease ArtM -
QRD25_RS08050 (QRD25_08050) 1683772..1684488 - 717 WP_004928413.1 arginine ABC transporter permease ArtQ -
QRD25_RS08055 (QRD25_08055) 1684498..1685229 - 732 WP_004928409.1 arginine ABC transporter substrate-binding protein -
QRD25_RS08060 (QRD25_08060) 1685262..1685990 - 729 WP_004928406.1 arginine ABC transporter ATP-binding protein ArtP -
QRD25_RS08065 (QRD25_08065) 1686254..1686796 - 543 WP_015377301.1 lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10789.91 Da        Isoelectric Point: 10.6941

>T284333 WP_033633469.1 NZ_CP127881:c1681827-1681543 [Serratia marcescens]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9108.39 Da        Isoelectric Point: 4.5203

>AT284333 WP_004928423.1 NZ_CP127881:c1682068-1681817 [Serratia marcescens]
MTVQPILADSAVSISDFKKSPNAALKEAQGQPVAVLTNGKISGYYVSPETWEAIAEYLEDIELAEIVRSRMNGKRIKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4GJ35

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4GIN1

References