Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1681543..1682068 | Replicon | chromosome |
| Accession | NZ_CP127881 | ||
| Organism | Serratia marcescens strain ELP1.10 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8B4GJ35 |
| Locus tag | QRD25_RS08030 | Protein ID | WP_033633469.1 |
| Coordinates | 1681543..1681827 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A8B4GIN1 |
| Locus tag | QRD25_RS08035 | Protein ID | WP_004928423.1 |
| Coordinates | 1681817..1682068 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD25_RS08005 (QRD25_08005) | 1676803..1677936 | + | 1134 | WP_004938650.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
| QRD25_RS08010 (QRD25_08010) | 1677961..1678923 | + | 963 | WP_021504359.1 | putrescine ABC transporter permease PotH | - |
| QRD25_RS08015 (QRD25_08015) | 1678920..1679765 | + | 846 | WP_004938644.1 | putrescine ABC transporter permease PotI | - |
| QRD25_RS08020 (QRD25_08020) | 1679870..1680349 | + | 480 | WP_015377294.1 | YbjO family protein | - |
| QRD25_RS08025 (QRD25_08025) | 1680419..1681546 | + | 1128 | WP_015377295.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
| QRD25_RS08030 (QRD25_08030) | 1681543..1681827 | - | 285 | WP_033633469.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRD25_RS08035 (QRD25_08035) | 1681817..1682068 | - | 252 | WP_004928423.1 | prevent-host-death protein | Antitoxin |
| QRD25_RS08040 (QRD25_08040) | 1682170..1682904 | - | 735 | WP_015377297.1 | arginine ABC transporter substrate-binding protein | - |
| QRD25_RS08045 (QRD25_08045) | 1683104..1683772 | - | 669 | WP_004928418.1 | arginine ABC transporter permease ArtM | - |
| QRD25_RS08050 (QRD25_08050) | 1683772..1684488 | - | 717 | WP_004928413.1 | arginine ABC transporter permease ArtQ | - |
| QRD25_RS08055 (QRD25_08055) | 1684498..1685229 | - | 732 | WP_004928409.1 | arginine ABC transporter substrate-binding protein | - |
| QRD25_RS08060 (QRD25_08060) | 1685262..1685990 | - | 729 | WP_004928406.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| QRD25_RS08065 (QRD25_08065) | 1686254..1686796 | - | 543 | WP_015377301.1 | lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10789.91 Da Isoelectric Point: 10.6941
>T284333 WP_033633469.1 NZ_CP127881:c1681827-1681543 [Serratia marcescens]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GJ35 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GIN1 |