Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1050674..1051295 Replicon chromosome
Accession NZ_CP127881
Organism Serratia marcescens strain ELP1.10

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag QRD25_RS04980 Protein ID WP_004940313.1
Coordinates 1050674..1050877 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag QRD25_RS04985 Protein ID WP_004940312.1
Coordinates 1050927..1051295 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRD25_RS04950 (QRD25_04950) 1046373..1046711 + 339 WP_004940327.1 P-II family nitrogen regulator -
QRD25_RS04955 (QRD25_04955) 1046748..1048034 + 1287 WP_004940322.1 ammonium transporter AmtB -
QRD25_RS04960 (QRD25_04960) 1048125..1048988 - 864 WP_004940320.1 acyl-CoA thioesterase II -
QRD25_RS04965 (QRD25_04965) 1049220..1049711 + 492 WP_016928846.1 YbaY family lipoprotein -
QRD25_RS04970 (QRD25_04970) 1049776..1050090 - 315 WP_015376856.1 MGMT family protein -
QRD25_RS04980 (QRD25_04980) 1050674..1050877 - 204 WP_004940313.1 HHA domain-containing protein Toxin
QRD25_RS04985 (QRD25_04985) 1050927..1051295 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
QRD25_RS04990 (QRD25_04990) 1051454..1051807 - 354 WP_004940311.1 hypothetical protein -
QRD25_RS04995 (QRD25_04995) 1052210..1052923 + 714 WP_286093897.1 ABC transporter ATP-binding protein -
QRD25_RS05000 (QRD25_05000) 1052920..1053777 + 858 WP_004940309.1 metal ABC transporter permease -
QRD25_RS05005 (QRD25_05005) 1053803..1054681 + 879 WP_286093898.1 metal ABC transporter substrate-binding protein -
QRD25_RS05010 (QRD25_05010) 1054788..1054928 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
QRD25_RS05015 (QRD25_05015) 1054941..1055195 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T284332 WP_004940313.1 NZ_CP127881:c1050877-1050674 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT284332 WP_004940312.1 NZ_CP127881:c1051295-1050927 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References