Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 200552..201188 | Replicon | chromosome |
| Accession | NZ_CP127874 | ||
| Organism | Priestia megaterium strain ELP1.24a | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | QRD24_RS01130 | Protein ID | WP_013055004.1 |
| Coordinates | 200838..201188 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | QRD24_RS01125 | Protein ID | WP_013055003.1 |
| Coordinates | 200552..200833 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD24_RS01100 (QRD24_01100) | 195918..196889 | + | 972 | WP_028410443.1 | UV DNA damage repair endonuclease UvsE | - |
| QRD24_RS01105 (QRD24_01105) | 196898..197500 | - | 603 | WP_098433927.1 | rhomboid family intramembrane serine protease | - |
| QRD24_RS01110 (QRD24_01110) | 197565..197930 | + | 366 | WP_025753519.1 | holo-ACP synthase | - |
| QRD24_RS01115 (QRD24_01115) | 197989..199047 | + | 1059 | WP_013055001.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRD24_RS01120 (QRD24_01120) | 199161..200351 | + | 1191 | WP_221841476.1 | alanine racemase | - |
| QRD24_RS01125 (QRD24_01125) | 200552..200833 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| QRD24_RS01130 (QRD24_01130) | 200838..201188 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRD24_RS01135 (QRD24_01135) | 201346..202182 | + | 837 | WP_013055005.1 | RsbT co-antagonist protein RsbRA | - |
| QRD24_RS01140 (QRD24_01140) | 202185..202541 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
| QRD24_RS01145 (QRD24_01145) | 202545..202946 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| QRD24_RS01150 (QRD24_01150) | 202960..203970 | + | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
| QRD24_RS01155 (QRD24_01155) | 204030..204362 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| QRD24_RS01160 (QRD24_01160) | 204359..204844 | + | 486 | WP_025753516.1 | anti-sigma B factor RsbW | - |
| QRD24_RS01165 (QRD24_01165) | 204810..205604 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T284330 WP_013055004.1 NZ_CP127874:200838-201188 [Priestia megaterium]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|