Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 5231475..5232178 | Replicon | chromosome |
| Accession | NZ_CP127873 | ||
| Organism | Klebsiella michiganensis strain ELP1.34B | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A8T6BCS1 |
| Locus tag | QRD21_RS24395 | Protein ID | WP_001616568.1 |
| Coordinates | 5231475..5231816 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A377WBK0 |
| Locus tag | QRD21_RS24400 | Protein ID | WP_053274373.1 |
| Coordinates | 5231837..5232178 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD21_RS24370 (QRD21_24370) | 5227088..5227882 | + | 795 | WP_254539716.1 | DNA/RNA non-specific endonuclease | - |
| QRD21_RS24375 (QRD21_24375) | 5228172..5228495 | + | 324 | WP_032747696.1 | endoribonuclease SymE | - |
| QRD21_RS24380 (QRD21_24380) | 5228642..5229075 | + | 434 | Protein_4792 | VOC family protein | - |
| QRD21_RS24385 (QRD21_24385) | 5229240..5229986 | + | 747 | WP_286114936.1 | hypothetical protein | - |
| QRD21_RS24390 (QRD21_24390) | 5230213..5231220 | - | 1008 | WP_000528271.1 | restriction endonuclease | - |
| QRD21_RS24395 (QRD21_24395) | 5231475..5231816 | - | 342 | WP_001616568.1 | TA system toxin CbtA family protein | Toxin |
| QRD21_RS24400 (QRD21_24400) | 5231837..5232178 | - | 342 | WP_053274373.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRD21_RS24405 (QRD21_24405) | 5232189..5232731 | - | 543 | WP_286114939.1 | DNA repair protein RadC | - |
| QRD21_RS24410 (QRD21_24410) | 5232744..5233184 | - | 441 | WP_121339957.1 | antirestriction protein | - |
| QRD21_RS24415 (QRD21_24415) | 5233215..5234036 | - | 822 | WP_286114941.1 | DUF932 domain-containing protein | - |
| QRD21_RS24420 (QRD21_24420) | 5234157..5234630 | - | 474 | WP_286114943.1 | hypothetical protein | - |
| QRD21_RS24425 (QRD21_24425) | 5234732..5235196 | - | 465 | WP_286114944.1 | hypothetical protein | - |
| QRD21_RS24430 (QRD21_24430) | 5235506..5236381 | - | 876 | WP_286114945.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5228642..5238167 | 9525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12746.75 Da Isoelectric Point: 9.6548
>T284329 WP_001616568.1 NZ_CP127873:c5231816-5231475 [Klebsiella michiganensis]
MKTLPATTPQAAKLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATTPQAAKLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12773.41 Da Isoelectric Point: 6.6253
>AT284329 WP_053274373.1 NZ_CP127873:c5232178-5231837 [Klebsiella michiganensis]
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAVYPTQR
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAVYPTQR
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|