Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5176196..5176772 | Replicon | chromosome |
| Accession | NZ_CP127873 | ||
| Organism | Klebsiella michiganensis strain ELP1.34B | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A1Q8YXR6 |
| Locus tag | QRD21_RS24140 | Protein ID | WP_046878034.1 |
| Coordinates | 5176485..5176772 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A1D8JNF7 |
| Locus tag | QRD21_RS24135 | Protein ID | WP_025108476.1 |
| Coordinates | 5176196..5176498 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRD21_RS24120 (QRD21_24120) | 5173035..5173370 | + | 336 | WP_046878037.1 | endoribonuclease SymE | - |
| QRD21_RS24125 (QRD21_24125) | 5173824..5174735 | + | 912 | WP_286114901.1 | acetamidase/formamidase family protein | - |
| QRD21_RS24130 (QRD21_24130) | 5174732..5176075 | + | 1344 | WP_049101852.1 | APC family permease | - |
| QRD21_RS24135 (QRD21_24135) | 5176196..5176498 | - | 303 | WP_025108476.1 | BrnA antitoxin family protein | Antitoxin |
| QRD21_RS24140 (QRD21_24140) | 5176485..5176772 | - | 288 | WP_046878034.1 | BrnT family toxin | Toxin |
| QRD21_RS24145 (QRD21_24145) | 5177032..5177475 | - | 444 | WP_047724618.1 | FosA family fosfomycin resistance glutathione transferase | - |
| QRD21_RS24150 (QRD21_24150) | 5177469..5178377 | - | 909 | WP_224260657.1 | LysR family transcriptional regulator | - |
| QRD21_RS24155 (QRD21_24155) | 5178465..5179247 | + | 783 | WP_286114906.1 | NAD(P)H-dependent oxidoreductase | - |
| QRD21_RS24160 (QRD21_24160) | 5179395..5179979 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| QRD21_RS24165 (QRD21_24165) | 5179997..5180797 | + | 801 | WP_046878031.1 | winged helix-turn-helix domain-containing protein | - |
| QRD21_RS24170 (QRD21_24170) | 5180794..5181312 | + | 519 | WP_004108661.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5165052..5176775 | 11723 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11210.69 Da Isoelectric Point: 7.4687
>T284328 WP_046878034.1 NZ_CP127873:c5176772-5176485 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YXR6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8JNF7 |