Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4491347..4491966 Replicon chromosome
Accession NZ_CP127873
Organism Klebsiella michiganensis strain ELP1.34B

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag QRD21_RS21010 Protein ID WP_004099646.1
Coordinates 4491748..4491966 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag QRD21_RS21005 Protein ID WP_004129911.1
Coordinates 4491347..4491721 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRD21_RS20995 (QRD21_20995) 4486501..4487694 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QRD21_RS21000 (QRD21_21000) 4487717..4490863 + 3147 WP_014228207.1 multidrug efflux RND transporter permease subunit AcrB -
QRD21_RS21005 (QRD21_21005) 4491347..4491721 + 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
QRD21_RS21010 (QRD21_21010) 4491748..4491966 + 219 WP_004099646.1 HHA domain-containing protein Toxin
QRD21_RS21015 (QRD21_21015) 4492129..4492695 + 567 WP_046876978.1 maltose O-acetyltransferase -
QRD21_RS21020 (QRD21_21020) 4492667..4492801 - 135 WP_224260031.1 hypothetical protein -
QRD21_RS21025 (QRD21_21025) 4492822..4493292 + 471 WP_014228205.1 YlaC family protein -
QRD21_RS21030 (QRD21_21030) 4493267..4494721 - 1455 WP_046876979.1 PLP-dependent aminotransferase family protein -
QRD21_RS21035 (QRD21_21035) 4494823..4495521 + 699 WP_224260030.1 GNAT family protein -
QRD21_RS21040 (QRD21_21040) 4495518..4495658 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
QRD21_RS21045 (QRD21_21045) 4495658..4495921 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T284326 WP_004099646.1 NZ_CP127873:4491748-4491966 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT284326 WP_004129911.1 NZ_CP127873:4491347-4491721 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References