Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 4762270..4762898 | Replicon | chromosome |
| Accession | NZ_CP127872 | ||
| Organism | Pseudomonas asiatica strain RYYT.1b | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V9X276 |
| Locus tag | QQ994_RS21485 | Protein ID | WP_025340378.1 |
| Coordinates | 4762716..4762898 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1L5PZ99 |
| Locus tag | QQ994_RS21480 | Protein ID | WP_038408384.1 |
| Coordinates | 4762270..4762695 (-) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ994_RS21470 (QQ994_21470) | 4758341..4759681 | + | 1341 | WP_075046131.1 | PLP-dependent aminotransferase family protein | - |
| QQ994_RS21475 (QQ994_21475) | 4759785..4762226 | + | 2442 | WP_075046132.1 | penicillin acylase family protein | - |
| QQ994_RS21480 (QQ994_21480) | 4762270..4762695 | - | 426 | WP_038408384.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QQ994_RS21485 (QQ994_21485) | 4762716..4762898 | - | 183 | WP_025340378.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QQ994_RS21490 (QQ994_21490) | 4763105..4764121 | + | 1017 | WP_085706037.1 | ligase-associated DNA damage response exonuclease | - |
| QQ994_RS21495 (QQ994_21495) | 4764118..4765776 | + | 1659 | WP_075046134.1 | ATP-dependent DNA ligase | - |
| QQ994_RS21500 (QQ994_21500) | 4765999..4767114 | + | 1116 | WP_075046135.1 | M14 family metallopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6895.01 Da Isoelectric Point: 11.1658
>T284317 WP_025340378.1 NZ_CP127872:c4762898-4762716 [Pseudomonas asiatica]
MKYSEFRRWLRGQGATFVAAKGSHFKVYLGNRQTIFPDHGAKEISEGLRRKILKDLGLKS
MKYSEFRRWLRGQGATFVAAKGSHFKVYLGNRQTIFPDHGAKEISEGLRRKILKDLGLKS
Download Length: 183 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15426.84 Da Isoelectric Point: 4.7494
>AT284317 WP_038408384.1 NZ_CP127872:c4762695-4762270 [Pseudomonas asiatica]
MVFEYPVVVHLEDGSVWVSCPDVPEMACAGDTSEEALFDAVDALESALSFYVDQKIAIPLPATPTEGQPVVRLPALTAAK
AALWNTMVAQKISKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALHVLGQRIELSVVAV
MVFEYPVVVHLEDGSVWVSCPDVPEMACAGDTSEEALFDAVDALESALSFYVDQKIAIPLPATPTEGQPVVRLPALTAAK
AALWNTMVAQKISKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALHVLGQRIELSVVAV
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V9X276 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L5PZ99 |