Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 3758393..3759276 | Replicon | chromosome |
Accession | NZ_CP127872 | ||
Organism | Pseudomonas asiatica strain RYYT.1b |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | QQ994_RS17030 | Protein ID | WP_286100121.1 |
Coordinates | 3758393..3758830 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | F8G488 |
Locus tag | QQ994_RS17035 | Protein ID | WP_013973163.1 |
Coordinates | 3758827..3759276 (-) | Length | 150 a.a. |
Genomic Context
Location: 3753605..3754669 (1065 bp)
Type: Others
Protein ID: WP_286100119.1
Type: Others
Protein ID: WP_286100119.1
Location: 3756110..3757036 (927 bp)
Type: Others
Protein ID: WP_025339647.1
Type: Others
Protein ID: WP_025339647.1
Location: 3757231..3758385 (1155 bp)
Type: Others
Protein ID: WP_286100120.1
Type: Others
Protein ID: WP_286100120.1
Location: 3760184..3761107 (924 bp)
Type: Others
Protein ID: WP_286100123.1
Type: Others
Protein ID: WP_286100123.1
Location: 3761155..3761985 (831 bp)
Type: Others
Protein ID: WP_025339652.1
Type: Others
Protein ID: WP_025339652.1
Location: 3762036..3762620 (585 bp)
Type: Others
Protein ID: WP_274120604.1
Type: Others
Protein ID: WP_274120604.1
Location: 3754740..3755969 (1230 bp)
Type: Others
Protein ID: WP_013973159.1
Type: Others
Protein ID: WP_013973159.1
Location: 3758393..3758830 (438 bp)
Type: Toxin
Protein ID: WP_286100121.1
Type: Toxin
Protein ID: WP_286100121.1
Location: 3758827..3759276 (450 bp)
Type: Antitoxin
Protein ID: WP_013973163.1
Type: Antitoxin
Protein ID: WP_013973163.1
Location: 3759426..3760079 (654 bp)
Type: Others
Protein ID: WP_286100122.1
Type: Others
Protein ID: WP_286100122.1
Location: 3762745..3763959 (1215 bp)
Type: Others
Protein ID: WP_286100124.1
Type: Others
Protein ID: WP_286100124.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ994_RS17010 (QQ994_17010) | 3753605..3754669 | + | 1065 | WP_286100119.1 | TerC family protein | - |
QQ994_RS17015 (QQ994_17015) | 3754740..3755969 | - | 1230 | WP_013973159.1 | acyl-CoA dehydrogenase | - |
QQ994_RS17020 (QQ994_17020) | 3756110..3757036 | + | 927 | WP_025339647.1 | LysR family transcriptional regulator | - |
QQ994_RS17025 (QQ994_17025) | 3757231..3758385 | + | 1155 | WP_286100120.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
QQ994_RS17030 (QQ994_17030) | 3758393..3758830 | - | 438 | WP_286100121.1 | RES family NAD+ phosphorylase | Toxin |
QQ994_RS17035 (QQ994_17035) | 3758827..3759276 | - | 450 | WP_013973163.1 | DUF2384 domain-containing protein | Antitoxin |
QQ994_RS17040 (QQ994_17040) | 3759426..3760079 | - | 654 | WP_286100122.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QQ994_RS17045 (QQ994_17045) | 3760184..3761107 | + | 924 | WP_286100123.1 | LysR family transcriptional regulator | - |
QQ994_RS17050 (QQ994_17050) | 3761155..3761985 | + | 831 | WP_025339652.1 | AraC family transcriptional regulator | - |
QQ994_RS17055 (QQ994_17055) | 3762036..3762620 | + | 585 | WP_274120604.1 | LysE family translocator | - |
QQ994_RS17060 (QQ994_17060) | 3762745..3763959 | - | 1215 | WP_286100124.1 | sugar transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15999.21 Da Isoelectric Point: 4.8258
>T284316 WP_286100121.1 NZ_CP127872:c3758830-3758393 [Pseudomonas asiatica]
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPAGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSSQTELTRGLGNRFLDECSALLLPVPSAIMPSTTNYLFNPRHPQANSAWLEVEDFTPDSRLF
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPAGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSSQTELTRGLGNRFLDECSALLLPVPSAIMPSTTNYLFNPRHPQANSAWLEVEDFTPDSRLF
Download Length: 438 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 17004.59 Da Isoelectric Point: 6.3405
>AT284316 WP_013973163.1 NZ_CP127872:c3759276-3758827 [Pseudomonas asiatica]
MLAEVLRDNGYHEYRARLHALLEIPELASDFEIHTRITHGFAATWLVKLTELGVFTPVERDQIIPLRTLKTRIERDQPLT
VEESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGFGL
MLAEVLRDNGYHEYRARLHALLEIPELASDFEIHTRITHGFAATWLVKLTELGVFTPVERDQIIPLRTLKTRIERDQPLT
VEESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGFGL
Download Length: 450 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | F8G488 |