Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2392595..2393111 | Replicon | chromosome |
| Accession | NZ_CP127872 | ||
| Organism | Pseudomonas asiatica strain RYYT.1b | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F8G1E7 |
| Locus tag | QQ994_RS11050 | Protein ID | WP_003259987.1 |
| Coordinates | 2392830..2393111 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | F8G1E6 |
| Locus tag | QQ994_RS11045 | Protein ID | WP_013972043.1 |
| Coordinates | 2392595..2392840 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ994_RS11025 (QQ994_11025) | 2387834..2388631 | - | 798 | WP_025338593.1 | SDR family oxidoreductase | - |
| QQ994_RS11030 (QQ994_11030) | 2388718..2389641 | - | 924 | WP_286101644.1 | LysR substrate-binding domain-containing protein | - |
| QQ994_RS11035 (QQ994_11035) | 2390021..2391214 | + | 1194 | WP_025338595.1 | MFS transporter | - |
| QQ994_RS11040 (QQ994_11040) | 2391245..2392351 | + | 1107 | WP_085663447.1 | alkene reductase | - |
| QQ994_RS11045 (QQ994_11045) | 2392595..2392840 | + | 246 | WP_013972043.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQ994_RS11050 (QQ994_11050) | 2392830..2393111 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ994_RS11055 (QQ994_11055) | 2393192..2393587 | - | 396 | WP_023662326.1 | hypothetical protein | - |
| QQ994_RS11060 (QQ994_11060) | 2393676..2394584 | - | 909 | WP_075044797.1 | LysR family transcriptional regulator | - |
| QQ994_RS11065 (QQ994_11065) | 2394876..2396180 | + | 1305 | WP_286101645.1 | MFS transporter | - |
| QQ994_RS11070 (QQ994_11070) | 2396211..2397452 | + | 1242 | WP_286101646.1 | Zn-dependent hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T284315 WP_003259987.1 NZ_CP127872:2392830-2393111 [Pseudomonas asiatica]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|