Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3675884..3676400 | Replicon | chromosome |
Accession | NZ_CP127871 | ||
Organism | Pseudomonas kurunegalensis strain ANKC.G2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QQ992_RS16470 | Protein ID | WP_286110307.1 |
Coordinates | 3675884..3676165 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QQ992_RS16475 | Protein ID | WP_286110308.1 |
Coordinates | 3676155..3676400 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ992_RS16445 (QQ992_16445) | 3670918..3671760 | - | 843 | WP_286110306.1 | FecR domain-containing protein | - |
QQ992_RS16450 (QQ992_16450) | 3671757..3672293 | - | 537 | WP_105946798.1 | RNA polymerase sigma factor | - |
QQ992_RS16455 (QQ992_16455) | 3672488..3672667 | + | 180 | WP_028699887.1 | hypothetical protein | - |
QQ992_RS16460 (QQ992_16460) | 3672671..3674083 | - | 1413 | WP_019097820.1 | amino acid permease | - |
QQ992_RS16465 (QQ992_16465) | 3674409..3675833 | + | 1425 | WP_105946766.1 | PLP-dependent aminotransferase family protein | - |
QQ992_RS16470 (QQ992_16470) | 3675884..3676165 | - | 282 | WP_286110307.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQ992_RS16475 (QQ992_16475) | 3676155..3676400 | - | 246 | WP_286110308.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QQ992_RS16480 (QQ992_16480) | 3676599..3677141 | + | 543 | WP_286110309.1 | WYL domain-containing protein | - |
QQ992_RS16485 (QQ992_16485) | 3677151..3677873 | - | 723 | WP_286110310.1 | hypothetical protein | - |
QQ992_RS16490 (QQ992_16490) | 3677951..3678253 | - | 303 | WP_060497247.1 | DUF3077 domain-containing protein | - |
QQ992_RS16495 (QQ992_16495) | 3678453..3679076 | + | 624 | WP_060497248.1 | glutathione S-transferase | - |
QQ992_RS16500 (QQ992_16500) | 3679129..3680298 | - | 1170 | WP_286110311.1 | MFS transporter | - |
QQ992_RS16505 (QQ992_16505) | 3680393..3681304 | + | 912 | WP_016711216.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10846.68 Da Isoelectric Point: 10.8164
>T284311 WP_286110307.1 NZ_CP127871:c3676165-3675884 [Pseudomonas kurunegalensis]
MTYKLEFLPSALKEWSKLGHTVREQIKKKLGERLQSPKVQADALRDLPNHYKIKLRASGYRLVYRVEDERIVVVVVSVGK
RERSGVYHAAQKR
MTYKLEFLPSALKEWSKLGHTVREQIKKKLGERLQSPKVQADALRDLPNHYKIKLRASGYRLVYRVEDERIVVVVVSVGK
RERSGVYHAAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|