Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1985671..1986191 Replicon chromosome
Accession NZ_CP127869
Organism Staphylococcus epidermidis strain NG02

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag QQ988_RS09420 Protein ID WP_070731256.1
Coordinates 1985671..1985979 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag QQ988_RS09425 Protein ID WP_070731254.1
Coordinates 1985976..1986191 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ988_RS09390 (QQ988_09390) 1980874..1981209 - 336 WP_172953380.1 pathogenicity island protein -
QQ988_RS09395 (QQ988_09395) 1981553..1982194 - 642 WP_286096807.1 pathogenicity island protein -
QQ988_RS09400 (QQ988_09400) 1982191..1982553 - 363 WP_070731262.1 hypothetical protein -
QQ988_RS09405 (QQ988_09405) 1982558..1982875 - 318 WP_083315461.1 hypothetical protein -
QQ988_RS09410 (QQ988_09410) 1983199..1984698 - 1500 WP_145392306.1 DNA primase family protein -
QQ988_RS09415 (QQ988_09415) 1984703..1985584 - 882 WP_070731258.1 primase alpha helix C-terminal domain-containing protein -
QQ988_RS09420 (QQ988_09420) 1985671..1985979 - 309 WP_070731256.1 DUF1474 family protein Toxin
QQ988_RS09425 (QQ988_09425) 1985976..1986191 - 216 WP_070731254.1 pathogenicity island protein Antitoxin
QQ988_RS09430 (QQ988_09430) 1986367..1986588 - 222 WP_070731252.1 helix-turn-helix transcriptional regulator -
QQ988_RS09435 (QQ988_09435) 1986601..1986810 - 210 WP_218085746.1 helix-turn-helix transcriptional regulator -
QQ988_RS09440 (QQ988_09440) 1986896..1987474 + 579 WP_083315459.1 helix-turn-helix transcriptional regulator -
QQ988_RS09445 (QQ988_09445) 1987484..1988590 + 1107 WP_286097128.1 tyrosine-type recombinase/integrase -
QQ988_RS09450 (QQ988_09450) 1988601..1988831 + 231 WP_002457572.1 hypothetical protein -
QQ988_RS09460 (QQ988_09460) 1989392..1989862 - 471 WP_001829588.1 SsrA-binding protein SmpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1975589..1992265 16676


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 12373.75 Da        Isoelectric Point: 5.4712

>T284309 WP_070731256.1 NZ_CP127869:c1985979-1985671 [Staphylococcus epidermidis]
MNWETKNLLSDLEVLKDRFKDLKDSHGWHFDEHYPYETNHVLNKDEMIKEGVSYHERRIHDDQMFDLLHLYTQQFDHILK
KFQEIEKTLPDNNSLATKSDNA

Download         Length: 309 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8783.91 Da        Isoelectric Point: 5.2185

>AT284309 WP_070731254.1 NZ_CP127869:c1986191-1985976 [Staphylococcus epidermidis]
MNKKQRETLEAIKYQLRISINNKFDTYEHIEERNGVEKITEISREKHLEYIMKFCVQELENNFDFEEENKK

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References