Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1007597..1008402 | Replicon | chromosome |
Accession | NZ_CP127869 | ||
Organism | Staphylococcus epidermidis strain NG02 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | QQ988_RS04905 | Protein ID | WP_002457885.1 |
Coordinates | 1008220..1008402 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | QQ988_RS04900 | Protein ID | WP_193620711.1 |
Coordinates | 1007597..1008196 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ988_RS04875 (QQ988_04875) | 1002808..1004264 | + | 1457 | Protein_925 | ABC transporter substrate-binding protein/permease | - |
QQ988_RS04880 (QQ988_04880) | 1004257..1004979 | + | 723 | WP_002493983.1 | amino acid ABC transporter ATP-binding protein | - |
QQ988_RS04885 (QQ988_04885) | 1005493..1005630 | + | 138 | WP_194086666.1 | hypothetical protein | - |
QQ988_RS04890 (QQ988_04890) | 1005842..1006972 | + | 1131 | WP_286097112.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QQ988_RS04895 (QQ988_04895) | 1006969..1007439 | + | 471 | WP_002446764.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QQ988_RS04900 (QQ988_04900) | 1007597..1008196 | + | 600 | WP_193620711.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QQ988_RS04905 (QQ988_04905) | 1008220..1008402 | + | 183 | WP_002457885.1 | SAS053 family protein | Toxin |
QQ988_RS04910 (QQ988_04910) | 1008554..1008958 | + | 405 | WP_193620712.1 | hypothetical protein | - |
QQ988_RS04915 (QQ988_04915) | 1009142..1010527 | + | 1386 | WP_193620713.1 | class II fumarate hydratase | - |
QQ988_RS04920 (QQ988_04920) | 1010888..1011712 | - | 825 | WP_193620714.1 | RluA family pseudouridine synthase | - |
QQ988_RS04925 (QQ988_04925) | 1011871..1013004 | + | 1134 | WP_002476978.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1005475..1005630 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7080.67 Da Isoelectric Point: 4.3016
>T284307 WP_002457885.1 NZ_CP127869:1008220-1008402 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQPHDNEVRSDFKNSK
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQPHDNEVRSDFKNSK
Download Length: 183 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22648.59 Da Isoelectric Point: 5.1497
>AT284307 WP_193620711.1 NZ_CP127869:1007597-1008196 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLGKEHAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENNAIDFISDKIKTKENKGKLTMQVLTIDENGKLDVSVRQGLMEAREIFLIITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLGKEHAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENNAIDFISDKIKTKENKGKLTMQVLTIDENGKLDVSVRQGLMEAREIFLIITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|