Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 842783..843312 | Replicon | chromosome |
Accession | NZ_CP127869 | ||
Organism | Staphylococcus epidermidis strain NG02 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | QQ988_RS03935 | Protein ID | WP_001829891.1 |
Coordinates | 842950..843312 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | QQ988_RS03930 | Protein ID | WP_001829931.1 |
Coordinates | 842783..842953 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ988_RS03905 (QQ988_03905) | 838607..839086 | + | 480 | WP_002494210.1 | PH domain-containing protein | - |
QQ988_RS03910 (QQ988_03910) | 839079..840584 | + | 1506 | WP_060556106.1 | PH domain-containing protein | - |
QQ988_RS03915 (QQ988_03915) | 840571..841080 | + | 510 | WP_002494208.1 | PH domain-containing protein | - |
QQ988_RS03920 (QQ988_03920) | 841128..841481 | + | 354 | WP_001829915.1 | holo-ACP synthase | - |
QQ988_RS03925 (QQ988_03925) | 841548..842696 | + | 1149 | WP_002494207.1 | alanine racemase | - |
QQ988_RS03930 (QQ988_03930) | 842783..842953 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQ988_RS03935 (QQ988_03935) | 842950..843312 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QQ988_RS03940 (QQ988_03940) | 843657..844658 | + | 1002 | WP_002494206.1 | PP2C family protein-serine/threonine phosphatase | - |
QQ988_RS03945 (QQ988_03945) | 844758..845084 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
QQ988_RS03950 (QQ988_03950) | 845086..845565 | + | 480 | WP_002474646.1 | anti-sigma B factor RsbW | - |
QQ988_RS03955 (QQ988_03955) | 845540..846310 | + | 771 | WP_002474636.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T284306 WP_001829891.1 NZ_CP127869:842950-843312 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |