Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 61782..62425 | Replicon | plasmid pMB7671_2 |
Accession | NZ_CP127850 | ||
Organism | Escherichia coli strain MB7671 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | PJZ59_RS23590 | Protein ID | WP_001044768.1 |
Coordinates | 61782..62198 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | PJZ59_RS23595 | Protein ID | WP_001261287.1 |
Coordinates | 62195..62425 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJZ59_RS23575 (PJZ59_23575) | 57086..58018 | - | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
PJZ59_RS23580 (PJZ59_23580) | 58022..59017 | - | 996 | WP_000246636.1 | hypothetical protein | - |
PJZ59_RS23585 (PJZ59_23585) | 59482..61620 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
PJZ59_RS23590 (PJZ59_23590) | 61782..62198 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PJZ59_RS23595 (PJZ59_23595) | 62195..62425 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PJZ59_RS23600 (PJZ59_23600) | 62732..65851 | + | 3120 | WP_023909028.1 | hypothetical protein | - |
PJZ59_RS23605 (PJZ59_23605) | 66114..67247 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(B) | - | 1..70343 | 70343 | |
- | flank | IS/Tn | - | - | 56446..56949 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T284293 WP_001044768.1 NZ_CP127850:c62198-61782 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |