Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 49192..49793 Replicon plasmid pMB7671_2
Accession NZ_CP127850
Organism Escherichia coli strain MB7671

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PJZ59_RS23545 Protein ID WP_001216034.1
Coordinates 49192..49572 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PJZ59_RS23550 Protein ID WP_001190712.1
Coordinates 49572..49793 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PJZ59_RS23505 (PJZ59_23505) 44572..44840 + 269 Protein_55 type II toxin-antitoxin system ParD family antitoxin -
PJZ59_RS23510 (PJZ59_23510) 44827..45116 + 290 Protein_56 type II toxin-antitoxin system RelE/ParE family toxin -
PJZ59_RS23515 (PJZ59_23515) 45183..45365 + 183 WP_042065278.1 hypothetical protein -
PJZ59_RS23520 (PJZ59_23520) 45486..46226 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
PJZ59_RS23525 (PJZ59_23525) 46511..47488 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
PJZ59_RS23530 (PJZ59_23530) 48284..48697 - 414 Protein_60 integrase core domain-containing protein -
PJZ59_RS23535 (PJZ59_23535) 48702..48980 - 279 Protein_61 pdcB -
PJZ59_RS23540 (PJZ59_23540) 49008..49187 - 180 WP_001513661.1 hypothetical protein -
PJZ59_RS23545 (PJZ59_23545) 49192..49572 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PJZ59_RS23550 (PJZ59_23550) 49572..49793 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PJZ59_RS23555 (PJZ59_23555) 49976..51532 + 1557 WP_001553856.1 type I restriction-modification system subunit M -
PJZ59_RS23560 (PJZ59_23560) 51529..52800 + 1272 WP_023142242.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(B) - 1..70343 70343


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T284292 WP_001216034.1 NZ_CP127850:c49572-49192 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT284292 WP_001190712.1 NZ_CP127850:c49793-49572 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References