Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 95961..96483 Replicon plasmid pMB7671_1
Accession NZ_CP127849
Organism Escherichia coli strain MB7671

Toxin (Protein)


Gene name relE Uniprot ID S1PVW2
Locus tag PJZ59_RS23160 Protein ID WP_001681795.1
Coordinates 96202..96483 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S1Q9V6
Locus tag PJZ59_RS23155 Protein ID WP_001681796.1
Coordinates 95961..96212 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PJZ59_RS23130 (PJZ59_23130) 91377..92009 - 633 WP_000152530.1 A24 family peptidase -
PJZ59_RS23135 (PJZ59_23135) 92044..92526 - 483 WP_021561187.1 lytic transglycosylase domain-containing protein -
PJZ59_RS23140 (PJZ59_23140) 92574..93110 - 537 WP_001011500.1 type 4 pilus major pilin -
PJZ59_RS23145 (PJZ59_23145) 93160..94260 - 1101 WP_001211427.1 type II secretion system F family protein -
PJZ59_RS23150 (PJZ59_23150) 94262..95770 - 1509 WP_012605185.1 ATPase, T2SS/T4P/T4SS family -
PJZ59_RS23155 (PJZ59_23155) 95961..96212 + 252 WP_001681796.1 hypothetical protein Antitoxin
PJZ59_RS23160 (PJZ59_23160) 96202..96483 + 282 WP_001681795.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PJZ59_RS23165 (PJZ59_23165) 96793..97245 - 453 WP_016238167.1 type IV pilus biogenesis protein PilP -
PJZ59_RS23170 (PJZ59_23170) 97235..98530 - 1296 WP_032325932.1 type 4b pilus protein PilO2 -
PJZ59_RS23175 (PJZ59_23175) 98551..100170 - 1620 WP_042014174.1 PilN family type IVB pilus formation outer membrane protein -
PJZ59_RS23180 (PJZ59_23180) 100201..100638 - 438 WP_001681791.1 type IV pilus biogenesis protein PilM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA5 - 1..108804 108804


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11122.01 Da        Isoelectric Point: 10.6249

>T284291 WP_001681795.1 NZ_CP127849:96202-96483 [Escherichia coli]
MTYELEFERRALKEWHKLGHTVREQFKKKLSERLKNPRVPAARLHGHTDRYKIKLRASGYRLVYQVIDEKIVLLVIAVGK
RESSEVYQMADIR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9124.33 Da        Isoelectric Point: 4.0610

>AT284291 WP_001681796.1 NZ_CP127849:95961-96212 [Escherichia coli]
MSYQILTTTAASITELKKNPMGTVAEGEGGAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVKVSL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PVW2

Antitoxin

Source ID Structure
AlphaFold DB S1Q9V6

References