Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1317642..1318267 | Replicon | chromosome |
Accession | NZ_CP127848 | ||
Organism | Escherichia coli strain MB7671 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PJZ59_RS06445 | Protein ID | WP_000911330.1 |
Coordinates | 1317869..1318267 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PJZ59_RS06440 | Protein ID | WP_000450524.1 |
Coordinates | 1317642..1317869 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJZ59_RS06415 (1313445) | 1313445..1313915 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PJZ59_RS06420 (1313915) | 1313915..1314487 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PJZ59_RS06425 (1314633) | 1314633..1315511 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PJZ59_RS06430 (1315528) | 1315528..1316562 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PJZ59_RS06435 (1316775) | 1316775..1317488 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PJZ59_RS06440 (1317642) | 1317642..1317869 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PJZ59_RS06445 (1317869) | 1317869..1318267 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PJZ59_RS06450 (1318414) | 1318414..1319277 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
PJZ59_RS06455 (1319292) | 1319292..1321307 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PJZ59_RS06460 (1321381) | 1321381..1322079 | + | 699 | WP_000679823.1 | esterase | - |
PJZ59_RS06465 (1322189) | 1322189..1322389 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T284282 WP_000911330.1 NZ_CP127848:1317869-1318267 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|