Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1339730..1340277 Replicon chromosome
Accession NZ_CP127846
Organism Vibrio parahaemolyticus strain VP16

Toxin (Protein)


Gene name relE Uniprot ID I3NI64
Locus tag QRT07_RS06285 Protein ID WP_011080278.1
Coordinates 1339975..1340277 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag QRT07_RS06280 Protein ID WP_005448240.1
Coordinates 1339730..1339987 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRT07_RS06235 (QRT07_06235) 1334950..1335366 + 417 WP_025539159.1 hypothetical protein -
QRT07_RS06240 (QRT07_06240) 1335644..1336696 - 1053 WP_046209702.1 IS91 family transposase -
QRT07_RS06245 (QRT07_06245) 1336693..1337580 - 888 WP_046209703.1 site-specific integrase -
QRT07_RS06250 (QRT07_06250) 1337856..1338284 + 429 WP_012841699.1 GNAT family N-acetyltransferase -
QRT07_RS06255 (QRT07_06255) 1338311..1338403 + 93 WP_079749344.1 DUF3265 domain-containing protein -
QRT07_RS06260 (QRT07_06260) 1338494..1338775 + 282 WP_025527476.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QRT07_RS06265 (QRT07_06265) 1338772..1339059 + 288 WP_025636735.1 type II toxin-antitoxin system RelE/ParE family toxin -
QRT07_RS06270 (QRT07_06270) 1339062..1339178 + 117 WP_080263216.1 DUF3265 domain-containing protein -
QRT07_RS06275 (QRT07_06275) 1339529..1339648 + 120 WP_286089474.1 DUF3265 domain-containing protein -
QRT07_RS06280 (QRT07_06280) 1339730..1339987 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRT07_RS06285 (QRT07_06285) 1339975..1340277 + 303 WP_011080278.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRT07_RS06290 (QRT07_06290) 1340316..1340405 + 90 WP_086375053.1 DUF3265 domain-containing protein -
QRT07_RS06295 (QRT07_06295) 1340868..1341455 + 588 WP_025636725.1 hypothetical protein -
QRT07_RS06300 (QRT07_06300) 1341639..1341968 + 330 WP_140310139.1 hypothetical protein -
QRT07_RS06305 (QRT07_06305) 1342338..1342601 + 264 WP_140330717.1 hypothetical protein -
QRT07_RS06310 (QRT07_06310) 1342630..1342722 + 93 WP_140065272.1 DUF3265 domain-containing protein -
QRT07_RS06315 (QRT07_06315) 1342995..1343060 + 66 Protein_1161 DUF3265 domain-containing protein -
QRT07_RS06320 (QRT07_06320) 1343308..1344360 - 1053 WP_046209702.1 IS91 family transposase -
QRT07_RS06325 (QRT07_06325) 1344357..1345244 - 888 WP_046209703.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 1332849..1350790 17941
- inside Genomic island - - 1332325..1398659 66334
- flank IS/Tn - - 1336693..1337580 887


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11624.53 Da        Isoelectric Point: 4.8951

>T284273 WP_011080278.1 NZ_CP127846:1339975-1340277 [Vibrio parahaemolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQAIFSKVERLEAFPESGRIPPELEHLSYREVVVNPCRIFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT284273 WP_005448240.1 NZ_CP127846:1339730-1339987 [Vibrio parahaemolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q0L5T4

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References