Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
| Location | 1338494..1339059 | Replicon | chromosome |
| Accession | NZ_CP127846 | ||
| Organism | Vibrio parahaemolyticus strain VP16 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QRT07_RS06265 | Protein ID | WP_025636735.1 |
| Coordinates | 1338772..1339059 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A4P8FZQ1 |
| Locus tag | QRT07_RS06260 | Protein ID | WP_025527476.1 |
| Coordinates | 1338494..1338775 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRT07_RS06230 (QRT07_06230) | 1334050..1334739 | + | 690 | WP_025635249.1 | DUF2971 domain-containing protein | - |
| QRT07_RS06235 (QRT07_06235) | 1334950..1335366 | + | 417 | WP_025539159.1 | hypothetical protein | - |
| QRT07_RS06240 (QRT07_06240) | 1335644..1336696 | - | 1053 | WP_046209702.1 | IS91 family transposase | - |
| QRT07_RS06245 (QRT07_06245) | 1336693..1337580 | - | 888 | WP_046209703.1 | site-specific integrase | - |
| QRT07_RS06250 (QRT07_06250) | 1337856..1338284 | + | 429 | WP_012841699.1 | GNAT family N-acetyltransferase | - |
| QRT07_RS06255 (QRT07_06255) | 1338311..1338403 | + | 93 | WP_079749344.1 | DUF3265 domain-containing protein | - |
| QRT07_RS06260 (QRT07_06260) | 1338494..1338775 | + | 282 | WP_025527476.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QRT07_RS06265 (QRT07_06265) | 1338772..1339059 | + | 288 | WP_025636735.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRT07_RS06270 (QRT07_06270) | 1339062..1339178 | + | 117 | WP_080263216.1 | DUF3265 domain-containing protein | - |
| QRT07_RS06275 (QRT07_06275) | 1339529..1339648 | + | 120 | WP_286089474.1 | DUF3265 domain-containing protein | - |
| QRT07_RS06280 (QRT07_06280) | 1339730..1339987 | + | 258 | WP_005448240.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRT07_RS06285 (QRT07_06285) | 1339975..1340277 | + | 303 | WP_011080278.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRT07_RS06290 (QRT07_06290) | 1340316..1340405 | + | 90 | WP_086375053.1 | DUF3265 domain-containing protein | - |
| QRT07_RS06295 (QRT07_06295) | 1340868..1341455 | + | 588 | WP_025636725.1 | hypothetical protein | - |
| QRT07_RS06300 (QRT07_06300) | 1341639..1341968 | + | 330 | WP_140310139.1 | hypothetical protein | - |
| QRT07_RS06305 (QRT07_06305) | 1342338..1342601 | + | 264 | WP_140330717.1 | hypothetical protein | - |
| QRT07_RS06310 (QRT07_06310) | 1342630..1342722 | + | 93 | WP_140065272.1 | DUF3265 domain-containing protein | - |
| QRT07_RS06315 (QRT07_06315) | 1342995..1343060 | + | 66 | Protein_1161 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1332325..1398659 | 66334 | |
| - | flank | IS/Tn | - | - | 1336693..1337580 | 887 | |
| - | inside | Integron | - | - | 1332849..1350790 | 17941 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11097.80 Da Isoelectric Point: 5.1098
>T284272 WP_025636735.1 NZ_CP127846:1338772-1339059 [Vibrio parahaemolyticus]
MKVVWSPLALQKLGDAAEFISLDNPFAAEKWVNEVFDKTELLSSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILTEDDV
MKVVWSPLALQKLGDAAEFISLDNPFAAEKWVNEVFDKTELLSSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILTEDDV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|